KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_2152Help
Entry
Blon_2152         CDS       T00794                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Blon_2152 (gpmA)
   01230 Biosynthesis of amino acids
    Blon_2152 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Blon_2152 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Blon_2152 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Blon_2152 (gpmA)
Enzymes [BR:bln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Blon_2152 (gpmA)
Exosome [BR:bln04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Blon_2152 (gpmA)
  Exosomal proteins of melanoma cells
   Blon_2152 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2377662..2378402)
Genome map
AA seq 246 aa AA seqDB search
MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVLPDIVFTSLLR
RAINTANIALDAADRLWIPVQRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWRRSYAT
PPPEIDPNDQYAQNNDPRYAGDPVPEAECLANVVERVKPYFESAIEPELKAGKTVLIAAH
GNSLRAIVKMLDNLSEEEIAKVNIPTAIPLLYELDENFKPIKPRGEYLDPEAAAAGAAAV
AAQGQK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaaactagtactgctccgtcatggacagagcgcatggaataaaaccaaccag
ttcaccggctgggtcgacgtaccgctgaccgagcagggtgaagccgaagccaagcgtggc
ggcgagctgctcaaggagaagaacgtccttccggacattgtgttcacctccctgctgcgt
cgcgccatcaataccgccaacatcgctctggatgccgcagatcgtctgtggatcccggtt
cagcgtgactggcgtctcaacgagcgtcactacggcgctctgcagggcaagaacaagacc
gagatccgcgaagagtacggcgatgagaagttcatgctgtggcgccgttcttacgccacc
ccgccgcccgagatcgacccgaacgaccagtacgcccagaacaacgacccgcgctatgcc
ggcgatccggttccggaagccgagtgcctggccaacgttgttgagcgtgtgaagccgtac
ttcgagtccgctatcgagccggagctcaaggccggaaagaccgtgctgattgctgcccac
ggcaactccctccgcgccatcgtcaagatgctggacaacctgtctgaggaagagatcgcc
aaggtcaacatcccgaccgccatcccgctgctttatgagctggacgagaacttcaagccg
atcaagccgcgtggcgagtacctggacccggaggctgctgctgccggtgccgctgctgtc
gccgctcagggccagaagtga

DBGET integrated database retrieval system