KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_2241Help
Entry
Blon_2241         CDS       T00794                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:bln01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bln00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bln00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bln00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bln00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bln00350]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bln00625]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:bln00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2470063..2472792)
Genome map
AA seq 909 aa AA seqDB search
MAEAKKKVEAAKPTPEEKRAAAEAEVDALVARAKKALDEFENLDQKQVDRIVAKASIAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTNYLAGQKTVGIIREDDVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIIFGFHPGAQKCSIEAAKIVRDAAIEAGAP
ENCIQWIEHPSIQATGALMQHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVDS
DVDIVRAANDLVLSKHFDYGMICATEQAIIAHKDVYDQLIKELKVRKAYFVNAEEKAKLE
QYMFGCAAGSGVKPVLNSVVPGKSPQFIAKAAGFEIPADATILAAECKEVSDDEPLTHEK
LAPVQAVLKADDKEQAFEMCEKMLKLGAGHTAAIHTNNQELVREYGVRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLVNIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKVIDQLRARSNRVTFRIIDYVEPEPSV
ETVEKGAEMMREEFEPDTIIAVGGGSPMDASKIMWLLYEHPEIAFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLAKTDA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGQIPEEP
TSWPKYNKYIAPERYQDIARNLGIDTGKTPAEAVENLAKAVEDYRDNKLGMNKSFQDCGV
DEDYFWSVLDQIGMRAYEDQCTPANPRIPLINDMKDIAVGAYYGVSQAEGHKLRIEREGE
AATEEASER
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaagcaaagaagaaggtcgaagccgccaagccgaccccggaagagaagcgggcc
gcagctgaggccgaggttgacgcgctggttgcccgtgccaagaaggctctcgacgaattc
gagaacctcgaccagaagcaagttgaccgtatcgtcgccaaggcctccatcgccgctctg
aacaagcacctcgttctcgccaagatggctgtcgacgagaccggccgtggtctcgtggaa
gacaaggccaccaagaacatcttcgcctgtgagcacgtcaccaactacttggccggccag
aagaccgtcggcatcatccgtgaagacgacgtgatgggcatcgatgaggtcgccgagccc
gtcggcgtggtagccggcgtcactccggttaccaacccgacctccaccgccatcttcaag
tccctcatcgccctgaagacacgctgcccgatcatcttcggcttccaccccggcgcgcag
aagtgctccatcgaggccgccaagattgtgcgcgacgccgccattgaggccggtgctccc
gagaactgtatccagtggatcgagcacccgtccatccaggccaccggcgcgctgatgcag
cacccgggcgtggccacgatcctcgccaccggtggtccgggcatggtcaaggccgcttac
tcctccggcaagcccgccctcggcgtgggtgccggcaacgccccggcctatgttgattcc
gatgtggacatcgtgcgtgccgccaacgatctggtgctctccaagcacttcgattacggc
atgatctgcgccaccgagcaggccatcatcgcccacaaggacgtctacgaccagctcatc
aaggagctcaaggtccgtaaggcctacttcgtcaacgccgaagagaaggccaagctggaa
cagtacatgttcggctgcgccgccggctccggcgtcaagcccgtgctgaactccgtggtg
ccgggcaagtccccgcagttcatcgccaaggccgccggcttcgagattccggccgacgcc
accattctggccgccgagtgcaaggaagtctccgacgacgagccgctgacccacgagaag
ctcgctccggtgcaggccgtgctcaaggccgacgacaaggagcaggccttcgagatgtgc
gagaagatgctcaagctgggtgccggccacaccgccgccatccacaccaacaaccaggag
ctcgtgcgtgagtacggcgtccgtatgcacgcctgccgcatcatctggaaccagccttcc
tcccttggcggcatcggcgacatctacaacgccatcgccccgtcgctgaccctgggctgc
ggctcctacggcggcaactcggtgtccggcaacgtgcaggccgtgaatctcgttaatatc
aagcgcattgctcggaggaacaacaacatgcagtggttcaagatcccggccaagacatac
ttcgagccgaacgccatcaagtacctgcgcgacatgtacggcatcgagaaggccgtcatc
gtgtgcgataaggtcatggaacagctcggcattgtcgacaaggtcatcgaccagctgcgc
gcccgctccaaccgtgtgaccttccgcatcatcgactacgtcgagccggagccctccgtc
gagaccgtcgaaaagggcgctgagatgatgcgcgaggagttcgagccggacacgatcatc
gcggtcggcggcggctccccgatggacgcctccaagatcatgtggctgctctacgagcac
ccggaaatcgccttctccgacgtgcgcgagaagttcttcgatatccgtaagcgcgcgttc
aagatcccgccgctgggcaagaaggccaagctcgtgtgcatcccgacctcctccggcacc
ggctccgaggtcaccccgttcgccgtgatcaccgatcacaagaccggctacaagtacccg
atcaccgactacgcgctgaccccgtccgtggccatcgtggacccggtgctggctcgcacc
cagccgcgcaagctggcctccgacgccggcttcgacgccctgacccactcgatggaagcc
tacgtgtccgtgtacgcgaacgacttcaccgacggcatggccctgcacgcggccaagctc
atctgggacaacctggctgagtccgtcaacggcgagcccggcctggccaagaccgacgct
caggagaagatgcacaacgccgccaccatggccggcatggcattcggctccgcgttcctc
ggcatgtgccacggcatggcccacaccatcggtgccctatgccacatcgcccacggccgc
accaactccatcctgctgccgtacgtgattcgctacaacggccagattcctgaggagccc
acctcttggccgaagtacaacaagtacatcgccccggagcgctaccaggacatcgcccgc
aacctcggcatcgacaccggcaagaccccggccgaagccgtggagaacctggcgaaggcc
gtcgaggactaccgcgacaacaagctcggcatgaacaagagcttccaggattgcggcgtg
gacgaggactacttctggtccgtgctcgatcagatcggcatgcgcgcctacgaggaccag
tgcaccccggccaacccgcgcatcccgctgatcaacgacatgaaggacatcgccgtcggt
gcctactacggcgtctcccaggcggaaggccacaagctgcgcatcgagcgcgagggcgag
gccgccactgaggaagcctccgagcgctga

DBGET integrated database retrieval system