KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_2246Help
Entry
Blon_2246         CDS       T00794                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Blon_2246
Enzymes [BR:bln01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Blon_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2478489..2480654)
Genome map
AA seq 721 aa AA seqDB search
MSEITESEERLARPLIRLAKLVGVGTSYVGMSHDYHEIDDDVLIEVLAALGIDASSENAQ
LIAIRRILNERYSRLVAPTVLHIAGSEDRVLVNTGILDVPSASITLENGEPYQGTVEVGP
GDGSQAYDLDGTFISNAAVVIPADLPIGYHTLHVKVADRVQDATLISAPDRVDLLDPMKG
GSLWGWMAQLYSIRSSNSWGVGDYEDLKTMLVDAKQKTGADFVLINPVHAAEPVSPLTPS
PYLPVSRRLINFTYIRPEAIVEYATLSEGDKNAVDGLHADTEPLNGDSQLIDRDAMWRSK
MHALWIIFKAGRTAERQSAFDQFKADYGSDLEAYATWCLCYDKWGAPNGEESNWERKFNR
NSPEIANLRKQYPDTLDFYRWLEWIAAEQLSSAQQTAKDAGMHIGIMSDMAVGVHPSGAD
VWWNPERFAKGATVGAPPDMFNQQGQNWSQPPLSPINLEATGYETYRNMVHGMFARAGAV
RIDHILGLFRLWWIPENRSAMDGAYVYYDSDIMLGVLAIEASRAGGVVVGEDLGVVPDHV
ADSLSSHGILGCAVEWFEQRDGVFRAPSQWRPYALASVNTHDLPPTAGYLEYEHVKIRER
LGLLTGPVEEFEASAKTEQDAMLAMLVEQGYLDADFAEHREDHEADIVDALYRALKGSPC
KLLAASITDAVGEKRAQNQPGTNNEYPNWRIPLADAKGNVVPLETLFDTPGAQRFAQIFN
S
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagattaccgagagtgaagagcgtctggcccgtccgttgattcgactggccaag
ttggtcggtgtcggcacgagttatgtgggcatgagccatgactaccacgagatagacgat
gacgtcctgatcgaggtgctggcagcgctgggcatcgacgcctccagcgagaacgcccaa
ctcatcgccatccgacgcattctgaacgagcgttactcccgattggtggcacccaccgtg
ctgcatatcgccggtagcgaggaccgggtgctggtgaacaccggtattctggacgtgcct
tcggcgagcatcacgctggagaatggcgagccatatcagggcaccgttgaagttggtcct
ggagatggatcccaggcctacgacttggatggcacgttcatttcgaatgcggctgtggtc
attcccgccgatctgccgatcggttaccatacactgcatgtcaaggtcgccgaccgtgtg
caagacgccactttgatcagtgcgcctgatcgcgtcgatctgcttgacccgatgaagggc
ggcagtctgtggggctggatggcccagctgtactcgattcgctcatccaactcctggggc
gtgggcgattacgaggatctgaagaccatgctggtggatgccaagcagaagaccggtgcc
gacttcgtgctcatcaatccggtgcatgccgccgagccggtgtccccgctcaccccgtcg
ccgtatctgccggtaagccgtcgcctgatcaacttcacgtacatccgccccgaggcgatc
gtcgaatatgccacgctcagcgagggcgacaagaacgccgtcgacgggctgcatgccgat
accgaaccgctgaacggtgattcccagctcatcgaccgtgacgccatgtggcgcagcaag
atgcacgccctgtggattatcttcaaggccggccgcaccgccgaacgccaaagcgcgttc
gaccaattcaaggcggactacggttccgacttggaggcgtatgccacgtggtgcctgtgc
tacgacaagtggggggcgcccaacggcgaggagagcaactgggagcgcaagttcaaccgc
aactccccggaaatcgccaatctgcgcaagcagtacccggacactttggacttctaccgc
tggctggaatggattgccgccgagcagctgtcctccgcccagcagacagccaaggacgcc
ggcatgcatatcggcatcatgtccgatatggccgtcggcgtgcacccctccggcgctgac
gtgtggtggaatcccgagcgcttcgccaagggagccacggtcggcgcaccgccggacatg
ttcaaccagcaaggccagaactggagccagccgccgctgagcccgatcaatctggaggcc
accggctacgagacctaccgcaatatggtgcatggcatgttcgcccgtgccggtgcggtg
cgcatcgaccacatccttggcctgttccgcctgtggtggattcccgagaaccgttcggct
atggatggcgcttacgtgtactacgactcagacatcatgctgggcgttctggccatcgag
gcctctcgtgccggcggcgtggtcgtaggtgaggacctcggcgtggtgccggaccatgtg
gccgattccctgtcgagccacggtattctcggttgcgccgttgaatggttcgagcagcgc
gacggcgtgttccgcgccccctcccagtggcgtccgtacgcattggcctccgtgaatacg
cacgatctgccgccgaccgccggttacctggaatacgagcacgtcaagattcgtgagcgt
ctgggcttgctgaccggcccggtcgaggaattcgaagcctccgcaaagaccgagcaggat
gcgatgctggccatgctggtcgagcagggctatcttgatgccgacttcgccgaacatcgt
gaggatcacgaggcggatatcgtcgacgcgctgtaccgcgcactgaagggttcgccgtgc
aagctgctcgccgcctcgatcaccgacgcggtgggggagaagcgtgcgcagaaccagccg
ggcactaacaacgaatacccgaactggcgcatcccgctggccgacgccaagggcaacgtg
gtaccgctcgaaaccctcttcgacacccccggcgcccaacgcttcgcccagatcttcaat
tcctga

DBGET integrated database retrieval system