KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_2298Help
Entry
Blon_2298         CDS       T00794                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Blon_2298
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Blon_2298
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Blon_2298
Enzymes [BR:bln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Blon_2298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2549476..2550609)
Genome map
AA seq 377 aa AA seqDB search
MSTPSQAEVRRMVAAAGTIVVKVGSSSLTQPSGHLDPDKLDALAAALAQIRLMGGRVVLV
SSGAIAAGFGPLGFDERPADVATQQATAAVGQGLLMARYETAFGRFGIRVGQILITAEDT
IRATQYRNVERTLDRLLDLGVVPIINENDSLASNEIRFGDNDRLSALVANLVRAEALVLL
TDVDALYTAPPSQPGSRRVEYVPNVIDALGDIQVSGSGSKVGTGGMVTKLEAARVAAVSG
IPTVLTCASNAGPAMMGDPVGTVFAPVKARGSSRRLWIGFAADPRGAIVVDAGAGQAIRG
GRASLLATGALEVHGDFSAGDPVWIDAESGEHLARGLAGFDSEEIPQMLGRNTAQLKRFL
GPQYAHPLIHRDNLVLV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcccagtcaggccgaggtgcggcgcatggtcgccgcagccggaaccattgtc
gtgaaagtcggctccagctcactgacccagccgagcggtcacctcgacccggacaagctc
gacgctctggctgccgcccttgcccaaatacgactgatgggcgggcgtgtagtactggtt
tcctctggtgctattgcggccggcttcggcccgctgggctttgacgaacgcccggccgac
gtggctactcagcaggccaccgcagcggtcggccaaggtttgctcatggctcgctacgag
actgcttttggccgtttcggtattcgcgtaggccagattctgattaccgctgaagacacg
attcgtgccacccagtaccgcaatgtggaacgcacgctggaccgtctgctcgacctcggc
gtggtgccgattatcaacgaaaacgattcgttggcctcgaacgagattcgtttcggcgat
aacgatcgactctccgccttggtagccaatctggtgcgggccgaagccttggtgctactg
accgacgtggacgcgctgtacactgcaccgccctcgcagcccggctcccgccgtgtggaa
tatgtgccgaacgttatcgatgcacttggcgacatccaagtctccggctccggctccaag
gtcggcaccggcggcatggtcaccaaactcgaggccgcgcgcgtggcggccgtctcgggc
atccccacggtactcacctgcgcctcgaacgcgggcccggcgatgatgggcgatccggtg
ggcaccgtgttcgcaccggttaaggcccgcggctcatcacgccgtctgtggattggtttt
gccgccgacccgcgcggcgcgattgtggtcgatgcgggtgccggccaggcgattcgcggc
gggcgtgcctcgctgctggctactggcgcgctcgaagtgcatggcgatttttccgccggc
gatccggtctggatcgatgccgaaagcggcgaacacctggcccgaggcctcgccggcttc
gattccgaagaaattccgcagatgctcgggcgtaacaccgcccaactcaagcgtttcctc
ggcccccagtatgcccacccactgattcatcgcgacaatctcgtgctcgtgtga

DBGET integrated database retrieval system