KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_2334Help
Entry
Blon_2334         CDS       T00794                                 

Definition
glycoside hydrolase family 2
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Blon_2334
  Lipid metabolism
   00600 Sphingolipid metabolism
    Blon_2334
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Blon_2334
Enzymes [BR:bln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Blon_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2598858..2601929
Genome map
AA seq 1023 aa AA seqDB search
MTDVTHVDRASQAWLTDPTVFEVNRTPAHSSHKWYARDPQSGQWSDLKQSLDGEWRVEVV
QAADINLEEEPATAESFDDSSFERIQVPGHLQTAGLMNHKYVNVQYPWDGHENPLEPNIP
ENNHVALYRRKFTVSAPVANAKQAGGSVSIVFHGMATAIYVWVNGAFVGYGEDGFTPNEF
DITGLLHDGENVVAVACYEYSSASWLEDQDFWRLHGLFRSVELAARPHVHIENTQIEADW
DPEAGTASLDAALTVLNATDAATVRATLKDADGNTVWQTTGDAEAQTALSSGPLQGIEPW
SAESPTLYELDVDVIDQAGDVIECTSQKVGFRRFRIEDGILTINGKRIVFKGADRHEFDA
ERGRAITEQDMIDDVVFCKRHNINSIRTSHYPNQERWYELCDEYGIYLIDETNLEAHGSW
SLPGDVLTEDTIVPGSKREWEGACVDRVNSMMRRDYNHPSVLIWSLGNESYVGDVFRAMY
KHVHDIDPNRPVHYEGVTHNRDYDDVTDIETRMYSHADEIEKYLKDDPKKPYLSCEYMHA
MGNSVGNMDEYTALERYPKYQGGFIWDFIDQAIYATQPDGTRSLRYGGDFGDRPSDYEFS
GDGLLFADRKPSPKAQEVKQLYSNVHIDVTKDSVSVKNDNLFTATGDYVFVLSVLADGKP
VWQSTRRFDVPAGETRTFDVAWPVAAYRADARELVLQVSQRLAKATDWAESGYELAFGQA
VVPADATATPDTKPADGTITVGRWNAGVRGAGREVLLSRTQGGMVSYTFAGNEFVLRRPA
ITTFRPLTDNDRGAGHGFERVQWLGAGRYARCVDNVLEQIDDSTLKGTYTYELATAQRTK
VTVSYTAHTDGRVNLHVEYPGEQGDLPTIPAFGIEWTLPVQYTNLRFFGTGPEETYLDRK
HAKLGVWNTNAFADHAPYLMPQETGNHEDVRWAEITDDHGHGMRVSRADGAAPFAVSLLP
YSSFMLEEAQHQDELPKPKHMFLRVLAAQMGVGGDDSWMSPVHPQYHIPADKPISLDVDL
ELI
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtcacacatgtcgatcgcgcatcgcaggcttggctgaccgacccgacggtg
ttcgaggtgaaccggactccggcccattccagccacaagtggtacgcccgtgacccccag
agcggacaatggtccgatctcaagcagagccttgacggcgagtggcgggtcgaagtcgtt
caggccgccgacatcaacctcgaagaggaacccgcgacggccgagtcgttcgacgactcc
tcgttcgagcgtatccaggttccgggccacctgcagacggccggtctgatgaaccacaag
tacgtgaacgtccagtatccgtgggacggccacgagaacccgttggaaccgaacatcccg
gaaaacaatcacgtcgcgctctaccgcaggaagttcaccgtctccgcccccgtggcaaac
gccaagcaggccggcggatcggtgtcgatcgtgttccacggcatggccacggcgatctac
gtgtgggtcaacggcgcgttcgtcggctatggcgaggatggcttcacgcccaacgagttc
gacatcaccgggctgctgcacgatggggagaacgtcgtggccgtcgcctgctacgaatac
tccagcgcctcctggcttgaggatcaggacttctggcgcctgcacggcctgttccgctcc
gtcgaactcgccgcccgcccgcacgtgcacatcgagaacacgcagatcgaagccgattgg
gatcccgaggccggcaccgcctccctcgatgccgcgctgaccgtgctcaacgcgaccgac
gcggccacggtccgcgcgaccctgaaggacgccgacggcaacacggtgtggcagacgacg
ggcgacgcggaggcgcagaccgcgctctccagcggaccgctgcagggcatcgaaccatgg
agcgccgaaagcccgacgctgtacgagcttgacgtcgacgtcatcgaccaggcgggcgac
gtcatcgaatgcacgtcccagaaggtcggtttccgccgcttccgcatcgaggacggcatc
ctgaccatcaacggcaagcgcatcgtgttcaagggcgccgaccgccacgagttcgacgcc
gaacgcggccgcgccatcaccgagcaggacatgatcgatgacgtggtcttctgcaagcgc
cacaacatcaactccatccgaacctcgcactacccgaaccaggaacgctggtacgaactg
tgcgacgagtacggcatctacctgatcgacgagaccaacctcgaagcccacggcagctgg
tccctgcccggagacgtcctcaccgaggacaccatcgtgccgggcagcaagcgcgaatgg
gaaggcgcctgcgtcgaccgcgtcaacagcatgatgcgtcgtgactacaaccacccgagc
gtgctgatctggtcgctgggcaacgaatcctacgtgggcgacgtgttccgcgccatgtac
aagcacgtgcacgacatcgacccgaaccgtccggtgcattacgagggcgtgacccacaac
cgtgactacgatgacgtcaccgacatcgagacccgcatgtactcgcatgccgacgaaatc
gagaagtacctgaaggacgacccgaagaagccgtacctctcctgcgaatacatgcacgcc
atgggcaactccgtgggcaacatggacgaatacacggcgctcgaacgctacccgaagtat
cagggcggcttcatctgggacttcatcgaccaggccatctacgccacccagcccgacggc
accaggagcctgcgctacggcggagacttcggcgaccgtccgtccgactacgagttctcc
ggcgacggcctgctgttcgccgaccgcaagccttcccccaaggcccaggaagtcaagcag
ctgtactcgaacgtccacatcgacgtgacgaaggattcggtgtccgtcaagaacgacaac
ctgttcaccgccaccggcgactacgtgttcgtcctgagcgttctcgccgacggcaagccg
gtctggcagtccacccggcgtttcgacgtgcccgccggtgagacccgcacgttcgatgtc
gcatggccggtggcggcgtaccgcgccgacgcccgcgaactggtgctgcaggtttcgcag
cgtctcgccaaggcgaccgattgggccgagagcggctacgagctcgccttcggacaggcg
gtggtgcccgcggacgccaccgcgacgcccgacacgaagccggccgatgggaccatcacc
gtgggccgttggaacgccggcgtgcgaggcgccggacgcgaggtcctgctgtcgcgcacc
cagggcggcatggtctcctacaccttcgccggcaacgagttcgtgctgcgccgtcccgca
atcaccaccttccgtccgctgaccgacaacgatcgcggcgctggtcatggcttcgagcgc
gtccagtggctgggcgccggccgctacgcccgctgcgtggacaacgtgctcgagcagatc
gacgacagcacgctcaagggcacgtacacgtatgagctcgccaccgcgcagcgcaccaag
gtgaccgtctcctacacggcccacaccgatggccgcgtgaacctgcacgtcgaatacccc
ggagagcagggcgacctgcccaccatcccggcgttcggcatcgaatggacgctgcctgtg
cagtacacgaacctgaggttcttcggcaccggcccggaggagacgtacctggaccgcaaa
cacgccaagctcggcgtgtggaacaccaacgccttcgccgatcatgcgccgtacctcatg
ccgcaggagacgggcaaccatgaggatgtgcgttgggccgagattaccgacgatcacggc
cacggcatgcgcgtcagccgcgccgatggcgccgcgccgttcgcggtaagcctgttgccg
tactccagcttcatgcttgaggaggcccagcaccaggacgagctgccgaagccgaagcac
atgttcctgcgcgtccttgccgcacagatgggcgtcggcggcgatgattcctggatgtcg
ccggtgcacccccagtaccatatcccggcggacaagccgatcagcctcgacgtcgatctc
gagctgatctga

DBGET integrated database retrieval system