KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_2401Help
Entry
Blon_2401         CDS       T00794                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Blon_2401
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Blon_2401
   00052 Galactose metabolism
    Blon_2401
   00500 Starch and sucrose metabolism
    Blon_2401
   00520 Amino sugar and nucleotide sugar metabolism
    Blon_2401
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Blon_2401
   00524 Butirosin and neomycin biosynthesis
    Blon_2401
Enzymes [BR:bln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Blon_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2686688..2687707
Genome map
AA seq 339 aa AA seqDB search
MSFASIIHQHTVISVDIGGTKIAAGLMCVDLDEQGRPRDMPALIRRYVIPTKARLGGTSV
LQRVVQAIRQCLDDGEIPFPLLGIGVASAGVIDGNGSVVSATSLIPGWAGIQLQAELSAT
FNVPAIVIGDVQAHALGEAHWGCGRQYQSLLVAAIGTGIGGAIIIDGKLVRGVHGACGHI
GHLPHPDAIGISCSCGCEGHVESIASGTGIADNYRRALQQNGHNTLPTDINGRAIAELAS
QGSTEAVTSITLAGTSLGDVLGGLINALDPDAVILSGSVVHSGELWMKSVKQGIQRQTLG
ILSRTPVLTGTLGGRAPLIGATSALCADLRSNKEQKYEY
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgcaagcataatccatcagcatacggtgatatccgtggacatcggcggcacc
aaaatcgccgctggtctcatgtgcgtagacctcgacgaacaaggaagaccgcgggacatg
ccagcgttgattcgacggtacgtcataccgacgaaagcacgtctcggcggcacctccgta
ttgcaacgcgtcgttcaagccattcgccagtgtctggacgatggtgagattcctttccca
ctattggggatcggtgtagcgagcgcaggagtcattgacggcaacggttcggtggtatca
gccacttcgttgattcccggttgggccggtattcaactgcaagccgaattatcggcaacg
ttcaacgtgcctgccatcgtcatcggagatgttcaggcacacgcccttggtgaagcgcac
tggggatgcggacgacaataccaatcactactggtcgccgccatcggcaccggtatcgga
ggcgcgataatcatcgacgggaaactggtacgcggcgtccacggagcctgtggccatatc
ggccatctgccgcatcccgacgccattggtatatcctgctcatgtggatgtgagggccat
gtggagtcaatcgcctcaggtaccggcattgccgataattatcgacgtgctctgcaacag
aacggacacaatactctccccaccgacatcaatggacgcgctatcgccgaactggccagt
caaggtagtacggaagccgtaaccagtatcactctggccggcacgagtctcggcgatgtt
cttggcggactaatcaatgcccttgatcccgatgccgtgatcctttccggctccgtagtc
cattctggagagctatggatgaaatctgtgaaacaaggcatccaaagacagaccttgggc
attctttcccgaacaccggttttgacaggaacactcggcggcagagcccctctcatcgga
gcaacatcagctctgtgcgccgacctcagatcaaataaggagcagaaatatgaatactaa

DBGET integrated database retrieval system