KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_2416Help
Entry
Blon_2416         CDS       T00794                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Blon_2416
Enzymes [BR:bln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Blon_2416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2705165..2707285
Genome map
AA seq 706 aa AA seqDB search
MTDTMAHTQPASPASPASPAPTITAPGGRFVFGGDWNPEQWDESTWADDIAKLERAGINE
ATINVFSWALIQPDESRYDFAMLDRIVDLLVAHDFGFVLATSTGALPAWIAQRYPDATRT
DYEGRRHRFGVRHNACPNSPNFLRLAGALAGKLAERYGANDHLIAWHISNELGGRCYCDN
CAAAFRVWLERKYGSIEALNRAWNANFWSHTYADFAQILPPNAISDGLDGERATLSACSI
DYKRFQSDSLLGTYVTERDAIRAFDAMHPITTNLMDTYEGADYFRWGREMDVISWDDYPF
PHTTPSDNAFKHDLMRGVGDGRPFMLMESTPNQTNWQECNVLRAPGRMRAESYQAVAHGA
DTVQYFQLKQSRGGFEKYHGAVISHGGREDERVYGEVRALGGELAAHGARFVGGLTEAPV
ALMFDWDSYWSTENISLLPKGFDYPDQVRRWYAPFHHRNIAVDVVPEDIDAGRLAGYRVL
VAPALMMAKPGVRELVEGFVRAGGTFLATVMAGMHDEHDNVILGGYPGAFREVCGMRMEE
MDMIPDGRDVRVVFGSGEGEDADTDGSRVSLVAGLIKLDGGARPLAAYAGDVFYRGTPAV
TVNDFGAGTAYFAGAVLDEAGMDAVVGDVVRRAGVTGIVSPEPVEVVTRRYPSRGESLTF
VINHADTATAWQDTPFAGCESVLDGTVLGRDLVLEPYGVTVVRTAA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccatggcacacacccaacccgcatcacccgcatcacccgcatcgcctgca
ccgaccatcaccgcaccgggcggccgcttcgtcttcggcggcgactggaaccccgagcag
tgggacgaatccacctgggcggacgacatcgccaaactcgaacgcgccggcatcaacgag
gccaccatcaacgtgttctcctgggcgctgatccagccggacgagagccgctacgacttc
gccatgctcgaccgcatcgtcgacctgctggtcgcgcacgacttcggcttcgtcctggcc
acgtccaccggcgcgctacccgcatggatcgcgcaacgctaccccgacgccacgcgcacc
gactacgaaggccgtcgccaccgcttcggcgtgcggcacaacgcctgcccgaattcgccg
aacttcctgcgcctggccggcgcgctggccggcaagctcgccgaacgctacggcgccaac
gaccatctgatcgcctggcacatctccaacgagctcggcggccgctgctactgcgacaac
tgcgccgccgccttccgcgtctggctcgaacgcaagtacggttcgatcgaggcgttgaac
cgcgcgtggaacgcgaacttctggagccatacctacgccgatttcgcccagatcctaccg
ccgaacgcgatcagcgacggactggacggcgagcgcgccactctgtccgcctgcagcatc
gactacaagcggttccagtccgactcgctgctgggcacctacgtcaccgagcgcgacgcg
atccgcgcgttcgacgcgatgcatccgatcaccacgaacctcatggacacctacgagggt
gccgattatttccgttgggggcgcgagatggacgtgatcagctgggacgattatccgttc
ccgcacaccacgccttccgacaatgcgttcaagcacgatctgatgcgcggcgtgggcgac
ggcaggccgttcatgctcatggagtcgacgccgaaccagacgaactggcaggagtgcaac
gtactgcgcgcgcccgggcggatgcgtgcggaaagctatcaggcggtcgcgcatggcgcg
gataccgtgcagtatttccagctcaagcagtcgcgcggcgggttcgagaagtaccatggc
gcggtgatctcgcacggcgggcgcgaggacgagcgcgtgtacggcgaggtgcgtgcgctc
ggcggcgagctggcggcgcacggcgcgcggttcgtgggcggtctgaccgaggcgccggtc
gcgctgatgttcgactgggattcgtattggtcgaccgagaacatttcgttgctgccgaag
ggcttcgactatccggatcaggtgcggcgctggtatgcgccgttccaccaccgcaacatc
gcggtggatgtggtgccggaagacattgacgccgggcggctggcgggctatcgcgtgctg
gtcgcgccggcgctcatgatggccaagccgggcgttcgtgagctggtcgaggggttcgtg
cgcgccggcggcacgttcctggcgacggtgatggcaggcatgcacgacgagcatgacaac
gtgatcctcggcggatacccgggcgcgttccgtgaggtgtgcggaatgcgcatggaggag
atggacatgatcccggacggccgcgacgtgcgtgtcgtgttcggttcgggcgagggcgag
gacgcggacacggacgggtcccgggtctcgctggttgccgggctgatcaagctcgacggc
ggggcgcgccctctggcggcctacgccggcgacgtgttctaccggggtacgccggcggtg
acggtgaacgatttcggcgcgggcacggcgtatttcgccggtgcggtgctggacgaggcc
ggcatggacgccgtggtcggcgacgtggtgcgccgggccggcgttaccggcatcgtctcg
ccggagccggtggaggtggttacgcggcggtacccgtcacgcggggagtcgttgacgttc
gtgatcaaccatgcggatacggccacggcgtggcaggatacgccgttcgccggatgcgag
tcggtgcttgacggcacggtactgggcagggatctggtgctggagccgtacggcgtgacg
gtggtgcgcaccgcggcatga

DBGET integrated database retrieval system