KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_2460Help
Entry
Blon_2460         CDS       T00794                                 

Definition
glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bln00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bln00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bln00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2777541..2779844)
Genome map
AA seq 767 aa AA seqDB search
MAENTSTFTGAAADGTALTAVYLTQPAANVAIGLVFAGSDLPRIVHWGRPLAKPDTLLAA
YDALKPQRVSGALDDTAWPSILPTQAESWIGEQRVVLRRAGVELFPKFTVTNIEAGGVLE
ATLDAVSGESYTDVAGHARATGPVRVPGVIVTARDEEQGVEVEWHLELLPGGLVRQKATV
TNLFGADAGAPLEIGKIELGFPLPESAGEILTTTGHHLRERSPQRQPLTVGRFEKPQLAG
RPDFDASLLLTAGVPGFGFEHGDAYSVHVGWSGNSVLSAERLPYTTGVIGGGELLFGGEV
TLAGPGEGQNSYDTPWLFGSYGDGLNEIAARFHSYVRSLHPRLFSHGRPVILNTWEAVYF
DHNFDTLKALADKAADSGVERFVVDDGWFGSRRDDTSGLGDWQIAQDVWPDGPKSLKALA
DYVHAKGMEFGLWFEPEMVNPDSDVARNHPDWILSPTAGRLPLQGRTQQVLDLTNPDAFD
YIYGCMDQLVGELGIDYIKWDHNKLVTEPGSRRSGRPAVHAQTLAVYNIFKGLKTAHSGL
EIESCSSGGGRVDLGILEHADRIWVSDCVDPVERADIQRYTSLLVPPAMMGEHVGASPAH
STQRATSQELRMAMAFFGHMGIEWNLLKEPDEALAKLAVWVAEFKKHRDWFAIDTCVHAD
SNDPAVRLDGMVMPNRDAAIYRFTQLTTSQTYPAAPVHLPGLDPERTYRVSPLDPSLDLT
GLTNGQSTLGWWNEEGVVLTGEALQRYGIRPPSLHPQQAVLFKAVAE
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacacctccactttcaccggtgccgccgctgacggtaccgcactcaccgcc
gtctacctgacccagcccgccgccaatgtggcgatcggtctggtgtttgccggcagcgac
ctgccgcgcatcgtccactggggtcgcccgctggccaagcccgacaccctgctggccgcc
tatgacgccctgaagccgcagcgcgtgtccggcgcgctcgacgacaccgcttggccgtcc
atcctgcccacccaggccgaaagctggatcggcgagcagcgcgtggtgctgcgccgcgcc
ggcgtcgagctcttccccaagttcaccgtgaccaatatcgaggccggcggcgtgctggaa
gccaccctcgatgccgtgtccggcgaaagctacaccgatgtggccggccatgcccgtgcc
accggtccggtccgcgtgcccggcgtcatagtcaccgcgcgcgatgaggagcagggcgtg
gaagtcgagtggcacctcgaactgctccccggcggcctggtccgtcagaaggccaccgta
accaacctgttcggtgcagacgccggagccccgctcgagatcggcaagatcgagctcggc
ttcccgctgcccgaatccgccggcgaaatcctcaccaccaccggtcaccatctacgtgaa
cgcagtccgcagcgccagccgctgaccgtcggccgtttcgaaaagccgcagctcgccggc
cgccctgacttcgacgcatccctgctcctgaccgccggcgtgcccggtttcggcttcgag
catggcgacgcctattcggtgcacgtgggctggagcggcaactccgtactgtccgccgaa
cgtctgccctacacgaccggcgtaatcggcggcggcgaactcctgttcggcggcgaagtg
acgctcgccggccccggcgaaggccagaactcctacgacaccccgtggctgttcggctcc
tatggcgatggcctcaatgagatcgccgcccgcttccactcctacgtgcgctccctgcat
ccgcgcctgttctcgcacggccgtccggtgatcctcaacacctgggaagctgtgtacttc
gaccacaacttcgatacgctgaaggcgctcgccgacaaggccgccgactccggcgtggaa
cgattcgtggtggatgacggttggttcggttcccgccgcgacgacacctccggcctcggt
gactggcagattgcgcaggacgtctggcccgatggcccgaagtccctgaaggcgctcgcc
gactacgtgcacgccaagggtatggaattcggcttgtggttcgagccggaaatggtcaac
cccgattccgatgtggcccgtaaccaccccgattggattctctcgcccactgccggccgt
ctgccgctgcagggccgcactcagcaggtgctcgatctgaccaatccggatgcgttcgac
tacatctacggctgcatggaccagcttgtcggcgagcttggtatcgattacatcaagtgg
gaccacaacaagctcgtcaccgagcccggttcccgccgctccggccgcccggccgtgcac
gcgcagacccttgccgtctacaacatcttcaagggcctcaagaccgcacattcgggcctt
gagatcgaaagctgctcctctggtggcggccgcgtggatcttggcatcctagagcacgcc
gatcgtatctgggtctccgactgcgtggacccggtcgagcgcgcggacatccagcgctac
acctcgctgctggtgccgccggcgatgatgggcgagcacgtgggcgccagtcccgcgcac
tccacccagcgtgccaccagccaggaactgcgcatggccatggcgttcttcggccacatg
ggcatcgaatggaacctgttgaaggagccggacgaggcgctcgccaagctggccgtgtgg
gtggccgaattcaagaagcaccgcgactggttcgccatcgacacctgcgtgcacgccgac
tccaacgatccggccgtgcgtctggacggtatggtgatgccgaaccgtgacgccgccatc
taccgcttcacccagctgaccacgagccagacctatccggccgcgcccgtgcatctgccc
ggacttgaccccgagcgcacctaccgtgtcagcccgcttgacccgagcttggatttgacc
ggtctgaccaacggccagagcactctcggctggtggaacgaggaaggcgtagtcctgacc
ggcgaagccctgcagcgttacggcatccgtcccccgtccctccaccctcagcaggcagta
ctgttcaaagctgtggcggagtga

DBGET integrated database retrieval system