KEGG   Bifidobacterium longum NCC2705: BL0047Help
Entry
BL0047            CDS       T00094                                 

Gene name
ppgK
Definition
(RefSeq) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00010  Glycolysis / Gluconeogenesis
blo00520  Amino sugar and nucleotide sugar metabolism
blo01100  Metabolic pathways
blo01110  Biosynthesis of secondary metabolites
blo01120  Microbial metabolism in diverse environments
blo01130  Biosynthesis of antibiotics
blo01200  Carbon metabolism
Module
blo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL0047 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    BL0047 (ppgK)
Enzymes [BR:blo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BL0047 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-GeneID: 1023030
NCBI-ProteinID: NP_695278
UniProt: Q8CY58
Position
57764..58531
Genome map
AA seq 255 aa AA seqDB search
MIETAQAFGVDIGGSGIKAAPVDLTKGDFAEPRLKILTPEVSTPQAVAKIVKQQLDHFEV
PESAPVGIAFPAPIKPGQKLDFMANLDQSWIGVDVTEVFSEACGRPVVVVNDADAAGLAE
VQFGAAKGQDGLVIATTLGTGIGTALIYNGVLIPNTELGHIILSAKHLDAEKYASSAIRE
NEELGYKKWAKRLTKYYGLMEKYFNPDLFTVGGGVSRQSEKFLPYVDIKTPIVPAKLRNQ
AGIVGAAYYASTKQQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaactgcacaggctttcggtgttgacattggcggttccggcatcaaggccgca
cctgtcgatctgaccaagggcgatttcgccgagccacgattgaagattctcactcccgag
gtctccactcctcaggccgtggccaaaatcgtcaagcagcagctcgaccacttcgaagtg
cctgaatccgcacccgttggcatcgctttccccgcgccgatcaagcccggccagaagctc
gacttcatggccaaccttgaccagtcttggattggcgtggacgttactgaagtgttctcc
gaagcctgcggccgcccggtcgtcgtggtaaacgacgccgacgccgccggcctggccgaa
gtccagttcggtgccgccaagggccaggatggtctggtcatcgccaccacactgggcacc
ggcatcggcaccgccttgatttacaacggcgtgctcatcccgaacaccgaactcggacac
atcatcctgagcgccaagcatctggacgccgagaagtatgcctcctccgcgattcgcgag
aatgaggaactgggctacaagaagtgggccaagcgtctgaccaagtactacggccttatg
gagaagtacttcaacccggacctgttcaccgtcggcggcggcgtgagccgtcagagcgaa
aagttcctgccgtacgtggatatcaagaccccgatcgtgcccgccaagctgcgtaaccag
gccggcatcgtcggtgccgcctactatgccagcaccaagcagcagtga

DBGET integrated database retrieval system