KEGG   Bifidobacterium longum NCC2705: BL0070Help
Entry
BL0070            CDS       T00094                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00230  Purine metabolism
blo01100  Metabolic pathways
Module
blo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BL0070 (gmk)
Enzymes [BR:blo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BL0070 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 CPT AAA_33
Motif
Other DBs
NCBI-GeneID: 1023150
NCBI-ProteinID: NP_695300
UniProt: Q8G813
Position
89687..90277
Genome map
AA seq 196 aa AA seqDB search
MTENTHAGRLIVLTGPTAVGKGTVEAKLRADHPEVWVSVSATTRAPRPGEVDGVNYWFLT
EDEFLAREAAGEFLETAVVHGMAHYGTLLKPVEEHLAAGVPTILEIDLQGARRVKQRAAE
LDLEVVYVFIAPPSFEELERRLIGRGTETAEQQARRLETAKVELAAESEFDVTIVNETVD
QAAADLWSVIAKEYGL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaacacccatgctggccgtctaatcgtcctgactggccccaccgcagtaggt
aagggcaccgtggaagccaagctgcgcgccgaccaccccgaagtgtgggtgtccgtctcc
gccaccacacgcgctccgcgcccgggcgaggttgatggcgtcaactattggttccttact
gaagacgagttcctggcccgcgaagcggccggtgagttcctggaaaccgccgtggtgcac
ggcatggcccactacggtacattgctcaagcctgtggaggaacatctggccgccggtgtg
cccacgattctggaaatcgacctgcagggtgcccgccgcgtcaagcagcgcgccgccgag
ctcgacctcgaagtggtgtacgtgttcatcgcgccgccaagcttcgaagagctcgagcgc
cgcctgatcggccgcggcaccgaaaccgccgaacaacaggcccgtcgcttggagaccgcc
aaggtggagctcgccgccgaaagcgaattcgacgtcaccatcgtcaacgaaaccgttgat
caggccgctgccgacctctggtccgtcatcgccaaggaatacgggctgtaa

DBGET integrated database retrieval system