KEGG   Bifidobacterium longum NCC2705: BL0070Help
Entry
BL0070            CDS       T00094                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:blo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
89687..90277
Genome map
AA seq 196 aa AA seqDB search
MTENTHAGRLIVLTGPTAVGKGTVEAKLRADHPEVWVSVSATTRAPRPGEVDGVNYWFLT
EDEFLAREAAGEFLETAVVHGMAHYGTLLKPVEEHLAAGVPTILEIDLQGARRVKQRAAE
LDLEVVYVFIAPPSFEELERRLIGRGTETAEQQARRLETAKVELAAESEFDVTIVNETVD
QAAADLWSVIAKEYGL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaacacccatgctggccgtctaatcgtcctgactggccccaccgcagtaggt
aagggcaccgtggaagccaagctgcgcgccgaccaccccgaagtgtgggtgtccgtctcc
gccaccacacgcgctccgcgcccgggcgaggttgatggcgtcaactattggttccttact
gaagacgagttcctggcccgcgaagcggccggtgagttcctggaaaccgccgtggtgcac
ggcatggcccactacggtacattgctcaagcctgtggaggaacatctggccgccggtgtg
cccacgattctggaaatcgacctgcagggtgcccgccgcgtcaagcagcgcgccgccgag
ctcgacctcgaagtggtgtacgtgttcatcgcgccgccaagcttcgaagagctcgagcgc
cgcctgatcggccgcggcaccgaaaccgccgaacaacaggcccgtcgcttggagaccgcc
aaggtggagctcgccgccgaaagcgaattcgacgtcaccatcgtcaacgaaaccgttgat
caggccgctgccgacctctggtccgtcatcgccaaggaatacgggctgtaa

DBGET integrated database retrieval system