KEGG   Bifidobacterium longum NCC2705: BL0228Help
Entry
BL0228            CDS       T00094                                 

Definition
fused dTDP-4-keto-L-rhamnose reductase and dTDP-4-keto-6-deoxyglucose-3,5-epimerase enzyme involved in rhamnose biosynthesis
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BL0228
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BL0228
Enzymes [BR:blo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     BL0228
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BL0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1133134..1134576)
Genome map
AA seq 480 aa AA seqDB search
MDFEKDLRAVETNIPGLIVFDLPVHGDNRGWFKENWQRAKMTALGLPDFGPVQNNISFNA
KKGVTRGIHAEPWDKYISIATGSVFGAWVDLRPGDSFGQVYTTVLDPSKAIYVPRGVGNS
FQALEDGTAYTYLVNAHWSLEQKKTYTFVNLADPDLNIQWPIPLEDSERSEADLHHPMLR
DAKPMAPRRTMVTGCNGQLGRAIRAYVDAHGLEGFEFHDIDTFDFSDPAQYDRFDWSLYG
TVINAGAYTAVDKAETPEGRVLAWKANAQGPALLAKVAREHNITLVHVSSDYVFDGTAEL
HDEEEAFAPLGVYGQSKAAGDIAVANCPRHYILRSSWVIGEGHNFVKTMMGLSDRVAKGE
LPEVTVVDDQYGRLTFTKDMAEAIFHLFDGGAAYGTYDLTGSGTVKSWADIARTVFDLTN
GNGGKVKPISTAEYFANAKAPVSPRPTYSALDLAKIEATGLDVPDWEESLKAYVTKELKK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgaaaaagatctgagggctgtggagacgaacatcccgggcttgatcgtgttc
gacctgccggtgcatggcgacaaccgtggctggttcaaggagaactggcagcgggcgaag
atgaccgcgctcggcctgccggatttcggtccggtgcagaacaacatcagcttcaacgcg
aagaagggcgtgacgcgaggcatccacgcggaaccgtgggacaagtacatctcgatcgcc
acgggcagcgtgttcggcgcgtgggtggacctgcgccccggcgactcgttcggccaggtg
tacacgaccgtattggatccatcgaaggcgatctacgtgccgcgtggcgtgggtaacagc
ttccaggcgttggaggacggcaccgcgtacacgtatctcgtgaacgcgcattggagtctg
gagcagaagaagacatacacgttcgtgaacctcgccgacccggacctgaacatccagtgg
ccgatcccgctggaggactccgaacgctccgaagcggacctgcaccatccgatgctcagg
gacgccaagcccatggccccgcgccgcacgatggtcaccggctgcaacggccagctcggc
cgcgcgatccgcgcctacgtggacgcgcatggtttggagggtttcgagttccacgacatc
gacacgttcgacttctccgacccggcccagtacgaccggttcgactggtcgctgtacggc
acggtcatcaacgcgggcgcgtacaccgcggtcgacaaggcggagaccccggaggggcgc
gtgctggcgtggaaggcgaacgcacagggccctgccctgctcgccaaagtcgcccgcgag
cacaacatcaccctggtgcacgtgtcgagcgattacgtgttcgacgggaccgccgaattg
catgacgaggaggaggcgttcgcgccgttgggcgtgtacgggcagtcgaaggccgcgggc
gacatcgcggtcgcgaactgtccgcgccattacatcctgcgttcgagctgggtgatcggt
gagggccataacttcgtgaagaccatgatgggcctgtccgacagggtcgcgaagggcgaa
ttgccggaggtgacggtggtggacgaccagtacggccgcctcacgttcaccaaggacatg
gccgaggcgatcttccacctgttcgacggcggcgcggcgtacggcacgtacgacctgacc
ggttccgggactgtgaagagttgggcggacatcgcgcgcacggtattcgatctgacgaac
ggcaacggtgggaaggtcaagccgatctcgaccgcggagtatttcgcgaacgcgaaggcg
ccggtgagccctcgtccgacgtattccgcgctggacctggccaagatcgaggccacgggc
ctggacgtgcctgattgggaggagtccctgaaggcatacgtcaccaaggaactcaagaag
tag

DBGET integrated database retrieval system