KEGG   Bifidobacterium longum NCC2705: BL0472Help
Entry
BL0472            CDS       T00094                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL0472
Enzymes [BR:blo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     BL0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1429018..1429935)
Genome map
AA seq 305 aa AA seqDB search
MVKNIAYATEEETLMGNGVNLRTLTNDGGSAVISDYGAHLLRWAPAGQPDVIWTPRTWHF
EAGQPVGGGVPVCFPWFGPGFVHGGQTAKRPIHGFARLRQWALDEGAFTSARVRYVLDSE
RLTTGEVPWIEDEPNVRFHAAYEVCASDTLTMTLTVTNTGGEPMSYEAALHSYLHVGDVL
GARLVGLRGATYLDATEAGFPPKLQEQPSVMFGDQPVDRVYYSDAALELQDHVLGRVIRI
GKTGSPQTVVWNPGEQGGNAIAHAKTGEWRGFVAVEAAACRDRIVALSPGESYMLSQSIA
VMPLG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaagaacatcgcttacgcaacggaagaagaaacacttatgggcaatggcgtcaat
ctgcgcacgctcaccaatgacggcggtagcgcggtaatcagcgattacggggcgcatctg
ctgcgctgggccccggcggggcagccggatgtaatctggacgccccgcacatggcatttc
gaagctggtcagccggttggcgggggagtgccggtgtgcttcccctggttcgggccgggg
tttgtgcatggcgggcagactgcgaagcgaccgattcatgggttcgcacgattgcgccag
tgggcgctggacgaaggggcgtttaccagtgcccgtgtgcggtatgtgctggattccgaa
cgactgacgactggcgaagtgccatggatcgaggatgaacccaacgtgcgtttccatgcc
gcatacgaggtgtgtgccagcgatacgctgacgatgacgctgaccgttaccaacacggga
ggtgagccgatgtcgtatgaggcggcgctgcactcgtatctgcatgtcggcgatgtgctc
ggcgcgcggctggtcggtttgcggggtgcaacatatctggatgccacggaagccggattc
ccgccaaaactacaagaacagccatcggtgatgttcggcgatcagccggtggaccgtgtg
tattattccgatgctgcactggaattgcaggaccatgtgctgggtcgtgtgattcgcatc
ggcaagaccggctcgccgcagacggtggtgtggaatcccggagagcagggcggcaacgcc
attgcccatgccaagacgggtgaatggcgtggctttgtggccgtggaggcagcggcgtgc
cgagaccgtatcgttgcccttagtccgggtgaatcgtatatgctttcgcagtccattgcc
gtgatgccgttggggtag

DBGET integrated database retrieval system