KEGG   Bifidobacterium longum NCC2705: BL0527Help
Entry
BL0527            CDS       T00094                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1490774..1493011
Genome map
AA seq 745 aa AA seqDB search
MTDAYGNDAATSTGTIADTTNNAASGAPQRAESTERLARPLIKLAKACGLATSFIDQLGT
YTEISDAALVAVLKALDVDASSDEAIVRSMTQLEVENSKRLLPSTIVATTGKPTGITLNC
SSDADITASIELEDGTAFGHFALLPNLNSGKPDLTIAPDLPMGYHTLTVTVDGREGKAAI
IAAPARIPMPEAVAEHQRWGWMTQMYSVRSRESWGIGDYGDLKRLLADAAEKSKADFMLI
NPIHAGAPIPPLEPSPYLPESRRFLNVTYIRPQDIPEYATLPADVRAQVDALHDSVAARN
DESTPMDINAAWEAKRPALRLIFEAGRNNKRELEFEHFKTTAGPDLDSFATWCLCFEVWG
APWGENRWFFEKTIDDPAVRQLVEEHHDLFEFNRWLQWIAAEQVNAAQQEALDHGMTLGL
MQDMAVGVHGLGADAWANPERFASGGVTVGCPPDFYNQQGQDWGQPPFNPRYLEATGYQV
YREMVHSMYEHAGAVRIDHVLGLFRLWWIPQGLGARNGAYVTYNHEAMLGVLAIEATRAG
GMVVGEDLGTVPDYVRRILADHGVLGTDVEWFNRVDDSPNAGDPYRAPKDYRKQALASVT
THDLPPTAGYLNFAHVKLREELHLLSEPVEAFAASAMAERTAMMNRLVENGYISQTVADD
VEGHVQEIVEAMHAMLTDTPSLLLQAALVDGVGECRSQNQPGTSREYSNWRVPLADSSGH
VVHTDEVFDLPRVQSLAAVMRREKR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcatacggcaacgacgcagcaaccagcaccggcaccatcgcagacaccacc
aacaacgccgcttccggtgccccgcagcgcgcggaaagcacggaacgactcgcccgcccg
ctcatcaagctcgccaaagcctgcggacttgccacctcattcatcgaccagctcggcacc
tacaccgaaatcagcgacgcggccttggtcgccgtactcaaggccctcgacgtggacgca
tccagcgacgaggccatcgtacgctccatgacccaacttgaggtggaaaacagcaaacgt
ttgctcccctccaccatcgtcgccaccaccggcaaaccgaccggcatcaccctgaactgc
tcgtcggacgcggacatcaccgcctccatcgaactggaggacggcaccgcgtttggccac
tttgccctgctgccgaacctcaattccggcaagccggacttgaccatcgcacccgacctg
ccgatgggttaccacacgctgaccgtcacggttgacgggcgcgagggcaaggcggccatc
atcgccgcccccgcgcgcattcccatgccggaggcggtcgccgagcaccagcggtggggc
tggatgacgcagatgtattccgtgcggtcccgcgaatcgtggggcatcggcgattacggc
gatctgaagcgtcttttggcagatgccgccgagaagtccaaggccgacttcatgctcatc
aatccgattcacgccggcgcgccgattccgccgcttgagccatcgccgtatctaccggaa
tcgcgccgattcctcaacgtgacgtacatccggccgcaggatatccccgaatatgccaca
ctgccggccgacgtgcgcgcgcaggtggatgcgctgcatgattcggtggccgcgcgcaac
gacgaatcgaccccgatggacatcaacgcggcgtgggaggccaagcgcccggcgctgcgc
ctgatcttcgaagcgggccgcaacaacaagcgcgagctcgaattcgagcatttcaagacc
accgccggcccggacctcgattccttcgccacatggtgcctgtgcttcgaggtatggggc
gcgccgtggggcgagaaccgttggttcttcgagaagaccatcgacgacccggccgtgcgc
cagctcgtcgaggagcaccacgacctgttcgagttcaaccgctggctgcagtggatcgct
gccgagcaggtgaacgccgcgcagcaggaggcgctggaccacggcatgacgctggggctg
atgcaggacatggccgtgggcgtgcacgggctcggcgcggatgcctgggccaatccggaa
cgcttcgcctcaggtggcgtcacggtcggctgcccgccggacttctataaccagcagggc
caggattggggccagccaccgttcaacccgcgctacctggaggccaccggctaccaggtg
taccgcgagatggtgcattcgatgtacgagcacgcgggcgcggtgcgcatcgaccatgtg
ctgggcttgttccgcctgtggtggattccgcaggggctcggtgcccgcaacggcgcatac
gtgacgtacaaccacgaggcgatgttgggagtactggccatcgaggccacgcgcgccgga
ggcatggtggttggcgaggatctgggcaccgtaccggattacgtgcgccgcattctggcc
gatcacggcgtgctcggcactgacgtggaatggttcaaccgcgtggacgattcgccgaac
gccggcgacccgtaccgtgcacccaaggactatcgcaaacaggcattggcctcggtgacc
acgcacgatctgccacccaccgccggctacctgaacttcgcacacgtcaagctgcgcgag
gagctgcatctcctgagcgagccggtggaggcattcgccgcctcggcgatggccgagcgc
acggccatgatgaaccgtctggtggagaacggctatatctcgcagaccgtggcggatgat
gtggaaggccatgtgcaggaaatcgtggaagcgatgcacgccatgctcaccgatacgccg
tcgctgctgctgcaggcagcgctggtggacggcgtgggcgaatgccgctcccagaatcag
ccgggcacttccagagagtattcgaactggcgcgtgccgctggcggacagctcaggccac
gtggtacataccgacgaggtcttcgacctgccacgcgtgcagtccctagccgccgtgatg
cgccgagagaagcggtga

DBGET integrated database retrieval system