KEGG   Bifidobacterium longum NCC2705: BL0536Help
Entry
BL0536            CDS       T00094                                 

Gene name
spl
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BL0536 (spl)
Enzymes [BR:blo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     BL0536 (spl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1503905..1505431)
Genome map
AA seq 508 aa AA seqDB search
MKNKVQLITYADRLGDGTLSSMTDILRTRFDGVYDGVHILPFFTPFDGADAGFDPIDHTK
VDERLGSWDDVAELSKTHNIMVDAIVNHMSWESKQFQDVLEKGEESEYYPMFLTMSSVFP
NGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSDEGWEYLMSIFDQ
MAASHVSYIRLDAVGYGAKEASTSCFMTPKTFKLISRLREEGVKRGLEILIEVHSYYKKQ
VEIASKVDRVYDFALPPLLLHSLFTGHVEPVAHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YLAARAVQFFLPGVPQVYYVGALAGRNDMELLRRTNNGRDINRHYYSTAEIDENLERPVV
KALNALAKFRNELSAFDGEFSYEVDGDTSITFRWTAADGASTAALTFEPGRGLGTDNATP
VASLAWSDAAGDHETHDLLANPPIADID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagtgcaactcatcacatacgccgatcgtctcggcgatggcactcttagc
tcgatgaccgacatcctgcgcacccgcttcgacggcgtgtatgacggcgtgcatatcctg
ccgttcttcactccgttcgatggtgcggatgcaggcttcgacccgatcgaccataccaaa
gtcgacgaacgtctcggcagctgggacgacgtcgccgaactctccaagacccacaacatc
atggtcgacgccatcgtcaaccacatgagttgggaatccaagcagttccaagatgtgctt
gaaaaaggtgaggaatccgagtattacccgatgtttctgaccatgagctccgtgttcccg
aacggcgccaccgaagaggacctggccggcatctaccgtccgcgtccgggcctgccgttc
acccactacaagttcgccggcaagacgcgcttggtctgggtgagcttcaccccgcagcag
gttgatattgacaccgattccgacgagggctgggaatacctcatgtcgattttcgaccag
atggccgcctctcacgtcagctacatccgcctcgacgccgtcggctatggcgccaaggaa
gccagcaccagctgcttcatgacccccaagacctttaagctcatctcccgtctgcgcgag
gagggcgtcaagcgcggccttgaaatcctcatcgaggttcacagctattacaagaagcag
gtggagatcgcctccaaggtggaccgcgtctacgatttcgccctgccgccgctgcttctg
cactcgctgttcaccggtcacgtcgaacccgtggcccactggaccgagatccgcccgaac
aacgccgtcaccgtgctcgatacgcacgatggcatcggcgtgatcgacatcggctccgac
cagctcgaccgctccctcaagggcctcgtgcccgacgaggacgtcgacaacctggtcaac
accatccatgccaacacccacggcgaatcccaggccgccaccggtgccgccgcgtccaac
ctcgacctctaccaggtcaactccacgtactactcggccctcggctgcaacgaccagcac
tacttggccgcccgcgccgtgcagttcttcctgccgggcgtgccgcaggtctactacgtg
ggcgcgctcgccggccgcaacgacatggaactgctgcgccgcaccaacaacggccgcgac
atcaaccgccactactactccaccgccgaaatcgatgaaaacctcgaacgcccggtggtc
aaggccctgaacgccctggccaagttccgcaacgagctgtctgcattcgatggcgagttc
agctacgaggtcgatggcgacacgtccatcaccttccgctggaccgccgccgacggcgcg
tccacggccgccctcaccttcgagcccggacgcggcctcggcacagacaacgccaccccg
gtcgccagccttgcctggagcgatgccgccggcgaccacgaaacccacgatctgctcgcc
aacccgccgattgccgatatcgactaa

DBGET integrated database retrieval system