KEGG   Bifidobacterium longum NCC2705: BL0728Help
Entry
BL0728            CDS       T00094                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:blo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BL0728 (ruvA)
Enzymes [BR:blo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BL0728 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
508508..509134
Genome map
AA seq 208 aa AA seqDB search
MIGMLTGRVESVETDTALIDVGGVGYEVRMSATDLSRLHAGQDTRVFTYMNLSQDAITLH
GFLDRDAKKTFLQLIKVSGIGPKVAQSLLSTLTPSQLAHAIADNDATALAKAPGLGKKGA
QKIILELKGSIDLSQIEGASAQAATSKSPVDTGTEQVVEGLISLGWRQQDAQQAVAEACA
ENDIPTPLATDDVPRVLRLALALMDRGR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcatgctgaccgggcgggttgaatcggtcgaaaccgataccgcattgattgat
gttgggggagtgggctacgaagtgcgcatgtccgccaccgacctgagccgtctgcacgcc
gggcaagacacccgcgtcttcacctatatgaacctctctcaggatgccattaccctgcat
ggattcctggatcgggacgccaagaaaaccttcctacaactcatcaaggtctccggcatt
gggcctaaagtggcccaatcgttactctccacactgacgccgagtcagttggcccacgcc
atcgccgacaacgacgccaccgcgctggccaaggctccggggctgggtaagaagggcgca
cagaagatcatcctcgagcttaagggctctattgatttgagtcagatcgagggtgcttcc
gctcaggcggcaacatccaagtctccggtggataccggtacggaacaggttgtcgaagga
ctgatttcgcttggctggcgtcagcaggacgcccagcaggccgttgccgaggcttgcgcc
gaaaacgacattcccacgccgcttgccaccgacgatgtgccgcgtgtgctacgtctggct
ttggcgctgatggataggggccgctga

DBGET integrated database retrieval system