KEGG   Bifidobacterium longum NCC2705: BL0755Help
Entry
BL0755            CDS       T00094                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BL0755 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL0755 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BL0755 (trpA)
Enzymes [BR:blo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BL0755 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(537018..537893)
Genome map
AA seq 291 aa AA seqDB search
MIMTNEATTPSGQPLGISHKPSKSGAMFTKFKAENKPAFIGYLPYGFPNPDVSLDAFKTM
VEHGVDAVEIGLPYSDPVMDGPVIQAAASIALNNGETIKRVFEAVETVANAGGVPLIMSY
WNLVYHYGVERFARDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSSTER
LETVARNARGFVYAAARMGVTGERATIDASPELLVERTRQAGAENVCVGIGVSTAEQGAK
VGSYADGVIVGSALVHTLLADDNKTARDPKEGLKLLAAKSEELAEGIHNAR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgattatgaccaacgaagcaaccacgccgtccggccagccgctgggcatcagccacaag
cccagcaagtcgggcgctatgttcaccaagttcaaggccgagaacaagcccgccttcatc
ggctacctgccctacggcttccctaacccggacgtctcgcttgacgccttcaagacgatg
gtcgagcacggcgtcgacgccgtggaaatcggcctgccgtactccgacccggtcatggac
ggcccggtcatccaggctgccgcctccatcgccctgaacaacggcgagaccatcaagcgc
gtgttcgaggccgtcgaaaccgtggccaacgccggcggcgtgccgctcatcatgagctac
tggaacctcgtgtaccactacggcgtcgagcgcttcgcccgcgacttcgagaacgccggc
ggcgccggtctcatcaccccggaccttatcccggacgaggcgggggagtggatcgaagcc
tccgaccgccacggactcgaccgcatcttcctggtctccccggactcgtccaccgagcgc
ctcgaaaccgtggcccgcaacgcacgtggcttcgtgtacgcggccgcccgcatgggcgtc
accggcgaacgcgccaccatcgacgcctcgcccgaactcctcgtggaacgtacccgtcag
gccggtgccgagaacgtgtgcgtgggcatcggcgtgtccaccgccgaacagggcgccaag
gtcggctcctacgcggacggcgtcatcgtcggctccgcgctcgtgcacaccctgctcgcg
gacgacaacaagaccgcacgcgacccgaaggaaggcttgaagctgctcgccgccaagagc
gaggaactggccgaaggcatccacaacgcccggtaa

DBGET integrated database retrieval system