KEGG   Bifidobacterium longum NCC2705: BL0756Help
Entry
BL0756            CDS       T00094                                 

Gene name
trpBC
Definition
bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BL0756 (trpBC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL0756 (trpBC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BL0756 (trpBC)
Enzymes [BR:blo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BL0756 (trpBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(537911..539998)
Genome map
AA seq 695 aa AA seqDB search
MSVLDELVAGALEDQRTRELTVSLEDVKKATLAAPAPIDATRWLKRADGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYEKGGASAISVLTEGRKFLGSLDDFDKVRAAVHIPVLRKDFI
VTDYQIFEARAHGADLVLLIVAALDDAQLKHLLDLAHELGMTVLVETHTREEIERARKAG
AKVIGINARNLKNLKVDVNKYNELAADLPDDVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADNHELAVERLVKAGAQVKASETTPLSEHQGPYWGQFGGRYVPEALITALDELER
VYTQAKADPEFHKEFMTLQQRYVGRPSPLTEAPRFSALVKEKTGLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAICACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPE
SGKHAIRFAPGTGQLGMFQGAKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKDIGR
VNYSWATDEEAMNAFRDLSQTEGIIPAIESSHAVAGAYKAAADLKAKGYDKAVMIVNISG
RGDKDMATAGKWFGYLTDDQAAALDVTGTHGNTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggacgaactggtggcgggagcgctggaggatcagcgcacccgtgagctc
accgtatcgcttgaggatgtgaagaaggccacgctggcggccccggctccgattgacgcg
acacgatggcttaagcgcgccgacggcatccccgtgatcgccgagatcaagcgcgcgtct
ccgtccaagggccacctgtccgacatcccggacccggccgcgctggcccgcgagtacgag
aagggcggcgcaagcgccatctccgtgctcaccgaaggccgcaaattcctcggcagcctt
gacgatttcgacaaggtccgcgccgccgtgcacattccagtgctgcgcaaggacttcatc
gtcaccgactaccagatcttcgaggcccgcgcccacggcgccgacctggtgctgctcatc
gtcgccgcattggacgacgcccagctcaagcacctgctcgacctggcgcacgagctcggc
atgaccgtgctggtggagacgcacacccgcgaagagatcgaacgcgcccgcaaggccggt
gccaaggtgatcggcatcaacgcgcgcaacctgaagaacctcaaggtggacgtgaacaaa
tacaacgaactcgcggccgatctgcccgatgacgtcatcaaggtggcggaatccggcgta
ttcggcgcggtcgaggtcgaagactacgcccgcgcgggagcggacgcggtactggtcggc
gagggcgtggccaccgccgacaatcatgaacttgcagtggaacgactagtaaaggcagga
gcacaagtgaaagcatccgaaacgaccccgctcagcgaacatcagggaccgtattggggc
cagttcggtggccgctatgtgcccgaggccctcatcaccgccctcgacgagcttgagcgc
gtgtacacgcaagccaaggccgaccccgaattccacaaggaattcatgacgctccagcag
cgttacgtggggcgcccgagcccgctgaccgaagccccgcgcttctccgcacttgtcaaa
gagaagactggtctcgacgcccgtatcttcctcaagcgcgaggacttgaaccacaccggc
gcgcacaagatcaacaacgcgctcggccaggcactgctcgtcaagcgcatgggcaagacc
cgcgtgatcgccgagaccggcgccggccagcacggcgtggccaccgccaccgtgtgcgcc
atgctcggcctcaagtgccgcatctacatgggccagatcgacgcccgccgtcaggccctc
aacgtggcccgcatgcgtatgctcggcgccgaagtggtcgaggtgacccttggcgacaag
atcctgaaggacgccatcaacgaagccctgcgcgactgggtcaccaacgtcaaggacacg
cactacctgctcggcaccgtcgcgggcccgcacccgttcccggccatggtgcgcgacttc
cagaagatcatcggcgaggaggccaagcagcagctccaggactggtacggcatcgaccat
ccggacgcgatctgcgcctgcgtgggcggcggctccaacgccatcggcgtgatgaacgcc
ttcctggacgacgagcgcgtgaacctctacggctacgaagccggcggcaacggccccgaa
tccggcaagcacgccatccgcttcgcccccggcaccggccagctcggcatgttccagggc
gccaagagctacctgctggaaaccgacgaaggccagacgctcgacacctactcgatctcc
gcaggcctcgactacgcttccgtgggccccgagcacgcatggctcaaggacatcggccgc
gtgaactacagctgggccaccgacgaggaggccatgaacgccttccgcgacctgagccag
accgagggcatcatccccgccatcgaaagctcgcacgccgtggccggcgcgtacaaagcc
gccgccgatctgaaggccaagggctatgacaaggccgtgatgatcgtgaacatctccggc
cgaggcgacaaggacatggccaccgccggcaagtggttcggttatctgaccgacgaccag
gccgccgcgctcgatgtgaccggcacccacggcaatactgtcgcctga

DBGET integrated database retrieval system