KEGG   Bifidobacterium longum NCC2705: BL0756Help
Entry
BL0756            CDS       T00094                                 

Gene name
trpBC
Definition
(RefSeq) bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00260  Glycine, serine and threonine metabolism
blo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
blo01100  Metabolic pathways
blo01110  Biosynthesis of secondary metabolites
blo01130  Biosynthesis of antibiotics
blo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL0756 (trpBC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BL0756 (trpBC)
Enzymes [BR:blo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BL0756 (trpBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PALP QRPTase_C
Motif
Other DBs
NCBI-GeneID: 1021911
NCBI-ProteinID: NP_695937
UniProt: Q8G690
Position
complement(537911..539998)
Genome map
AA seq 695 aa AA seqDB search
MSVLDELVAGALEDQRTRELTVSLEDVKKATLAAPAPIDATRWLKRADGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYEKGGASAISVLTEGRKFLGSLDDFDKVRAAVHIPVLRKDFI
VTDYQIFEARAHGADLVLLIVAALDDAQLKHLLDLAHELGMTVLVETHTREEIERARKAG
AKVIGINARNLKNLKVDVNKYNELAADLPDDVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADNHELAVERLVKAGAQVKASETTPLSEHQGPYWGQFGGRYVPEALITALDELER
VYTQAKADPEFHKEFMTLQQRYVGRPSPLTEAPRFSALVKEKTGLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAICACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPE
SGKHAIRFAPGTGQLGMFQGAKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKDIGR
VNYSWATDEEAMNAFRDLSQTEGIIPAIESSHAVAGAYKAAADLKAKGYDKAVMIVNISG
RGDKDMATAGKWFGYLTDDQAAALDVTGTHGNTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggacgaactggtggcgggagcgctggaggatcagcgcacccgtgagctc
accgtatcgcttgaggatgtgaagaaggccacgctggcggccccggctccgattgacgcg
acacgatggcttaagcgcgccgacggcatccccgtgatcgccgagatcaagcgcgcgtct
ccgtccaagggccacctgtccgacatcccggacccggccgcgctggcccgcgagtacgag
aagggcggcgcaagcgccatctccgtgctcaccgaaggccgcaaattcctcggcagcctt
gacgatttcgacaaggtccgcgccgccgtgcacattccagtgctgcgcaaggacttcatc
gtcaccgactaccagatcttcgaggcccgcgcccacggcgccgacctggtgctgctcatc
gtcgccgcattggacgacgcccagctcaagcacctgctcgacctggcgcacgagctcggc
atgaccgtgctggtggagacgcacacccgcgaagagatcgaacgcgcccgcaaggccggt
gccaaggtgatcggcatcaacgcgcgcaacctgaagaacctcaaggtggacgtgaacaaa
tacaacgaactcgcggccgatctgcccgatgacgtcatcaaggtggcggaatccggcgta
ttcggcgcggtcgaggtcgaagactacgcccgcgcgggagcggacgcggtactggtcggc
gagggcgtggccaccgccgacaatcatgaacttgcagtggaacgactagtaaaggcagga
gcacaagtgaaagcatccgaaacgaccccgctcagcgaacatcagggaccgtattggggc
cagttcggtggccgctatgtgcccgaggccctcatcaccgccctcgacgagcttgagcgc
gtgtacacgcaagccaaggccgaccccgaattccacaaggaattcatgacgctccagcag
cgttacgtggggcgcccgagcccgctgaccgaagccccgcgcttctccgcacttgtcaaa
gagaagactggtctcgacgcccgtatcttcctcaagcgcgaggacttgaaccacaccggc
gcgcacaagatcaacaacgcgctcggccaggcactgctcgtcaagcgcatgggcaagacc
cgcgtgatcgccgagaccggcgccggccagcacggcgtggccaccgccaccgtgtgcgcc
atgctcggcctcaagtgccgcatctacatgggccagatcgacgcccgccgtcaggccctc
aacgtggcccgcatgcgtatgctcggcgccgaagtggtcgaggtgacccttggcgacaag
atcctgaaggacgccatcaacgaagccctgcgcgactgggtcaccaacgtcaaggacacg
cactacctgctcggcaccgtcgcgggcccgcacccgttcccggccatggtgcgcgacttc
cagaagatcatcggcgaggaggccaagcagcagctccaggactggtacggcatcgaccat
ccggacgcgatctgcgcctgcgtgggcggcggctccaacgccatcggcgtgatgaacgcc
ttcctggacgacgagcgcgtgaacctctacggctacgaagccggcggcaacggccccgaa
tccggcaagcacgccatccgcttcgcccccggcaccggccagctcggcatgttccagggc
gccaagagctacctgctggaaaccgacgaaggccagacgctcgacacctactcgatctcc
gcaggcctcgactacgcttccgtgggccccgagcacgcatggctcaaggacatcggccgc
gtgaactacagctgggccaccgacgaggaggccatgaacgccttccgcgacctgagccag
accgagggcatcatccccgccatcgaaagctcgcacgccgtggccggcgcgtacaaagcc
gccgccgatctgaaggccaagggctatgacaaggccgtgatgatcgtgaacatctccggc
cgaggcgacaaggacatggccaccgccggcaagtggttcggttatctgaccgacgaccag
gccgccgcgctcgatgtgaccggcacccacggcaatactgtcgcctga

DBGET integrated database retrieval system