KEGG   Bifidobacterium longum NCC2705: BL0875Help
Entry
BL0875            CDS       T00094                                 

Definition
hypothetical protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BL0875
  Amino acid metabolism
   00300 Lysine biosynthesis
    BL0875
Enzymes [BR:blo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BL0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(661321..662607)
Genome map
AA seq 428 aa AA seqDB search
METDRDIAFVDHLDVVPADDGWTHDAFDPQVIGDIVIGRGSLDNKGVALTSYFLLRFFKE
HDHRFRHRVRILFGGSEEIALNDIKWFVANIGAPYQAIVTDGPFPVNNIQKGLLDVDVEL
PVGPQLRGWHAGTATNTVPGAAAITLTGVDESTVRQAFCQSGNIAPDIAERLHINATAQG
VTIEATGVAGHACQPSGTVNAIAVLTTALARSGLLEGRDLTAAQAIAQWTKDSYGTGLGI
DCENAESGPTTANGGLIIPANEFAEADKVLGAVSGETSEDAIVLHFDIRYAVGQAHEQII
ERIQAQAEAAGGRIVDILNDDPYYVQADDPRVQLLTATYNDVLGCEARPVAVGDGTHARF
IPRALNFGPEFHADHVPAVDGIDLETPPFIAPGAGNAHGADEWASLKNLKTAFVLYALGL
VRLDQYLQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtggagaccgaccgtgacatcgccttcgtcgaccacctcgacgtagtccccgccgacgac
ggttggacgcacgatgccttcgatccgcaggttattggcgatattgttatcggtcgcggc
tcattggacaataaaggcgtcgcgctgaccagctatttcctactccgtttcttcaaggaa
cacgaccaccgtttccgccaccgcgtacgtatactgttcggcggctccgaagagatcgcg
ctcaacgacatcaaatggttcgtcgccaacatcggcgcgccgtaccaggccatcgtcacc
gatggtcccttcccggtgaacaatatccaaaaagggctgctcgatgtggatgtcgaactg
ccggtcgggccgcaattgcgcggttggcatgccggcaccgccactaacacggttcccggg
gccgccgcaatcaccctcaccggcgtcgacgaatctaccgtgcggcaagcattctgccag
agcggcaacatcgctccagatatcgccgagcgattgcatatcaacgcaacagcgcaaggc
gtcacgattgaggccaccggtgtcgccggtcatgcctgccagccgtccggtaccgtaaac
gctatagcggtgctcactacggcgcttgcccggtccggtctgctcgaaggccgtgacctc
actgcagcgcaggcgattgcccaatggacaaaagactcatatggcaccggcttgggtatc
gattgcgagaatgcggaaagcggaccgactaccgccaatggtggtttgattataccggcg
aatgagttcgctgaagcagacaaggtattaggcgcggtatcgggtgagacttctgaagat
gccatcgtattgcacttcgacatccgttatgcggtaggccaggcacacgaacaaatcatc
gagcgtattcaagcacaagccgaagcggcgggcggccgcattgtcgacatccttaacgat
gacccatactacgtgcaggctgacgacccgcgtgtccagttgctcaccgcaacctacaac
gacgtgctcggttgcgaggctcgacccgtggctgtcggcgacggcacccacgcccgcttt
atcccgcgcgcactcaacttcggtcccgaattccatgccgaccatgtgccggcggtcgac
ggcatcgacctggagaccccgccattcatcgcaccaggtgccggcaacgcgcacggtgcc
gatgaatgggcctcgctgaaaaacctgaaaacagcgtttgtcctatatgcgttaggccta
gtgcgtctcgaccaatacctgcaatag

DBGET integrated database retrieval system