KEGG   Bifidobacterium longum NCC2705: BL0897Help
Entry
BL0897            CDS       T00094                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BL0897 (pncA)
Enzymes [BR:blo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BL0897 (pncA)
    3.5.1.-  
     BL0897 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
687103..687717
Genome map
AA seq 204 aa AA seqDB search
MTKALIVVDVQPTFCESGELGVAGGNAVAERIADYVNAHRSEYAYIATTQDWHIEPGAHW
SAEPDFVDTWPKHGAAGTLNAELHPAIKALNIEHHFKKGQYSAAYSGFEGIEDNTDRIQT
REEVEAEQSAGKTLANALKAAGVSRVDVVGIAESHCVKDTALDAKKLGFEVTVFEDLTVP
VSEELGVAARKQMAAGGITLAESR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcactgattgtggtggatgtgcagccgacgttctgtgaaagcggcgaactg
ggtgtcgcaggcggcaacgcggtcgccgagcggattgccgattatgtgaacgcgcatcgc
agcgagtacgcgtatatcgcaaccacgcaggactggcatatcgagccgggcgcgcactgg
tcggcggagccggatttcgtggacacgtggccgaagcatggtgcggccggcacgctgaac
gccgaattgcatccggcgatcaaggcgctgaatatcgagcatcatttcaagaagggccag
tattcggcggcatattccggttttgagggtatcgaggacaataccgaccgtatccagacc
cgcgaggaggtcgaggccgagcaatccgccggcaagacgctggccaacgcgctgaaggcc
gccggcgtgagtcgcgtggatgtggtgggcatcgccgaatcgcattgtgtcaaggacacc
gcgctcgatgccaagaagctcggcttcgaggtcaccgtgttcgaggatctgaccgtgccg
gtcagcgaggaacttggtgttgcggcccgcaagcagatggctgcgggcggcatcacattg
gctgagtcccgctga

DBGET integrated database retrieval system