KEGG   Bifidobacterium longum NCC2705: BL0978Help
Entry
BL0978            CDS       T00094                                 

Gene name
lacZ
Definition
LacZ
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BL0978 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    BL0978 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BL0978 (lacZ)
Enzymes [BR:blo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BL0978 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
790385..793456
Genome map
AA seq 1023 aa AA seqDB search
MTDVTHVDRASQAWLTDPTVFEVNRTPAHSSHKWYARDPQSGQWSDLKQSLDGEWRVEVV
QAADINLEEEPATAESFDDSSFERIQVPGHLQTAGLMNHKYVNVQYPWDGHENPLEPNIP
ENNHVALYRRKFTVSAPVANAKQAGGSVSIVFHGMATAIYVWVNGAFVGYGEDGFTPNEF
DITELLHDGENVVAVACYEYSSASWLEDQDFWRLHGLFRSVELAARPHVHIENTQIEADW
DPEAGTASLDAALTVLNAADAATVRATLKDADGNTVWQTTGDAEAQTAISSGPLQGIAPW
SAESPTLYELDVDVIDQAGDVIECTSQKVGFRRFRIEDGILTINGKRIVFKGADRHEFDA
ERGRAITEQDMIDDVVFCKRHNINSIRTSHYPNQERWYELCDEYGIYLIDEANLEAHGSW
SLPGDVLTEDTIVPGSKREWEGACVDRVNSMMRRDYNHPSVLIWSLGNESYVGDVFRAMY
KHVHDIDPNRPVHYEGVTHNRDYDDVTDIETRMYSHADEIEKYLKDDPKKPYLSCEYMHA
MGNSVGNMDEYTALERYPKYQGGFIWDFIDQAIYATQPDGTRSLRYGGDFGDRPSDYEFS
GDGLLFADRKPSPKAQEVKQLYSNVHIDVTKDSVSVKNDNLFTATGDYVFVLSVLADGKP
VWQSTRRFDVPAGETHTFDVAWPVAAYRADARELVLQVSQRLAKATDWAESGYELAFGQA
VVPADATATPDTKPADGTITVGRWNAGVRGAGREVLLSRTQGGMVSYTFAGNEFVLRRPA
ITTFRPLTDNDRGAGHGFERVQWLGAGRYARCVDNVLEQIDDSTLKGTYTYELATAQRTK
VTVSYTAHTDGRVNLHVEYPGEQGGLPTIPAFGIEWTLPVQYTNLRFFGTGPEETYLDRK
HAKLGVWSTNAFADHAPYLMPQETGNHEDVRWAEITDDHGHGMRVSRADGAAPFAVSLLP
YSSFMLEEAQHQDELPKPKHMFLRVLAAQMGVGGDDSWMSPVHPQYHIPADKPISLDVDL
ELI
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtcacacatgtcgatcgcgcatcgcaggcttggctgaccgacccgacggtg
ttcgaggtgaaccggactccggcccattccagccacaagtggtacgcccgcgacccccag
agcggacaatggtccgatctcaagcagagccttgacggcgagtggcgggtcgaggtcgtt
caggccgccgacatcaacctcgaagaggaacccgcgacggccgagtcgttcgacgactcc
tcgttcgagcgtatccaggttccgggccacctgcagacggccggtctgatgaaccacaag
tacgtgaacgtccagtatccgtgggacggccacgagaacccgttggaaccgaacatcccg
gagaacaatcacgtcgcgctctaccgcaggaagttcaccgtctccgcccccgtggcaaac
gccaagcaggccggcggatcggtgtcgatcgtgttccacggcatggccacggcgatctac
gtgtgggtcaacggcgcgttcgtcggctatggcgaggacggcttcacgcccaatgagttc
gacatcaccgaactgctgcacgacggggagaacgtcgtggccgtcgcctgctacgaatac
tccagcgcctcctggcttgaggatcaggacttctggcgtctgcacggcctgttccgctcc
gtcgaactcgccgcccgcccgcatgtgcacatcgagaacacgcagatcgaagccgattgg
gatcccgaggccggcaccgcctccctcgatgccgcgctgaccgtgctcaacgcggccgac
gcggccacggtccgcgcgaccctgaaggacgccgacggcaacacggtgtggcagacgacg
ggcgacgcggaggcgcagaccgcgatctccagcgggccgctgcagggcatcgccccttgg
agcgccgaaagcccgacgctgtacgagcttgacgtcgacgtcatcgaccaggcgggcgac
gtcatcgaatgcacgtcccagaaggtcggtttccgccgcttccgcatcgaggacggcatc
ctgaccatcaacggcaagcgcatcgtgttcaagggcgccgaccgccacgagttcgacgcc
gaacggggccgcgccatcaccgagcaggacatgatcgatgacgtggtcttctgcaagcgc
cacaacatcaactccatccgcacctcgcactacccgaaccaggaacgctggtacgaactg
tgcgacgagtacggcatctacctgatcgacgaagccaacctcgaagcccacggcagctgg
tccctgcccggagacgtcctcaccgaggacaccatcgtgccgggcagcaagcgcgaatgg
gaaggcgcctgcgtcgaccgcgtcaacagcatgatgcgccgcgactacaaccacccgagc
gtgctgatctggtcgctgggcaacgaatcctacgtgggcgacgtgttccgcgccatgtac
aagcacgtgcacgacatcgacccgaaccgtccggtgcactacgagggcgtgacccacaac
cgtgactacgatgacgtcaccgacatcgagacccgcatgtactcgcatgccgacgagatc
gagaagtacctgaaggacgacccgaagaagccgtacctctcctgcgaatacatgcacgcc
atgggcaactccgtgggcaacatggacgaatacacggcgctcgaacgctacccgaagtat
cagggcggcttcatctgggacttcatcgaccaggccatctacgccacccagcccgacggc
accaggagcctgcgctacggcggagactttggcgaccgtccgtccgactacgagttctcc
ggcgacggcctgctgttcgccgaccgcaagccttcccccaaggcccaggaagtcaagcag
ctgtactcgaacgtccacatcgacgtgacgaaggattcggtgtccgtcaagaacgacaac
ctgttcaccgccaccggcgactacgtgttcgttctgagcgttctcgccgacggcaagccg
gtctggcagtccacccggcgtttcgacgtgccggccggtgagacccacacgttcgatgtc
gcatggccggtggcggcgtaccgcgccgacgcccgcgaactggtgctgcaggtttcgcag
cgtctcgccaaggcgaccgattgggccgagagcggctacgagctcgccttcggacaggcc
gtggtgcccgcggacgccaccgcgacgcccgacacgaagccggccgatgggaccatcacc
gtgggccgttggaacgccggcgtgcgaggcgccggacgcgaggtcctgctgtcgcgcacc
cagggcggcatggtctcctacaccttcgccggcaacgagttcgtgctgcgccgtcccgca
atcaccaccttccgtccgctgaccgacaacgatcgcggtgccggtcatggcttcgagcgc
gtccagtggttgggcgccggacgctacgcccgttgcgtggacaacgtgctcgagcagatc
gacgacagcacgctcaagggcacgtacacgtatgagctcgccaccgcgcagcgcaccaag
gtgaccgtctcctacacggcccacaccgatggccgcgtgaacctgcacgtcgaataccct
ggagagcagggtggcctgcccaccatcccggcgttcggcatcgaatggacgctgcctgtg
cagtacacgaacctgaggttcttcggcaccggcccggaggagacgtacctggaccgcaaa
cacgccaagctcggcgtgtggagcaccaacgctttcgcggatcatgcgccgtacctcatg
ccgcaggagacgggcaaccatgaggatgtgcgttgggccgagattaccgacgatcacggc
cacggcatgcgcgtcagccgcgccgatggtgccgcgccgttcgcggtaagcctgttgccg
tactccagcttcatgcttgaggaggctcagcaccaggacgagctgccgaagccgaagcac
atgttcctgcgcgtccttgccgcacagatgggcgttggcggcgatgattcctggatgtcg
ccggtgcacccccagtaccatatcccggcggacaagccgatcagcctcgatgtcgacctc
gagctgatctga

DBGET integrated database retrieval system