KEGG   Bifidobacterium longum NCC2705: BL1036Help
Entry
BL1036            CDS       T00094                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BL1036 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL1036 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BL1036 (thrC)
Enzymes [BR:blo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BL1036 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
861136..862626
Genome map
AA seq 496 aa AA seqDB search
MTTTFHSTRSTNDSLTAKQAIRKGIADDGGLFVSDALGKTKVDVASLPGKSYQQIAAEVL
GALLPDFTAEELGQCIADAYGEQWSDERITPLKPLGDDYVLELFNGPTSAFKDVALQILP
RFMAHTTPADGDADEKIMILTATSGDTGKAALAGFADAPGTAITVFYPEGKVSQVQELQM
TTQAGSNVQVAAVEGNFDDAQSAVKRIFGDRALAERLAGNSHVVLSSANSINVGRLVPQV
VYYFSAYAQLLADQVINVGDEVEFVVPTGNFGDILAGYYAKLLGLPVKHLVVASDKNNVL
FDFLTTGTYNRQRPFFQTISPSMDILISSNLERMLYYLSEGDTRLISMLMNDLNKWGTYE
IPEELLAKIRQIFGTGWADEDQVRESIKHCWDEHHYVIDPHTACGYYLLEQMPRDPLTPR
VLLSTASPYKFPRVVNEALGFDATGTDFECMDVLAHETGTTAPAALRGLETADVRFKDVV
AIDGMEDYVEKAAQAL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccaccttccattccacccgtagcaccaacgattcgctgaccgccaagcaggcg
attcgtaagggcatcgccgatgacggcggcctgttcgtttcggacgcgttgggcaagacc
aaggtggacgtggcctccctgccgggcaagtcgtaccagcagatcgccgccgaggtgctg
ggcgcgctgctgccggacttcacggccgaggagctgggccagtgcatcgccgacgcctac
ggcgaacagtggtccgatgagcgcatcaccccactcaagcccctgggtgacgattacgtg
ctcgaactgttcaacggtccgacttccgcgttcaaggacgtggcgctgcagatcctgccg
cgcttcatggcgcacaccacgccggccgatggcgacgcggacgagaagatcatgatcctc
accgccacctccggcgacaccggcaaggccgcgctggccggcttcgcggacgccccgggc
accgcgatcaccgtcttctacccggaaggcaaggtctcccaggtccaggaactgcagatg
accacgcaggccggctccaacgtgcaggtggccgccgtggaaggcaacttcgacgacgcc
cagtccgcggtcaagcgcatcttcggcgaccgtgccctggccgagcgtctcgccggcaat
tcgcacgtggtgctttcctccgccaactccatcaacgtgggccgtctggtgccgcaggtc
gtctactacttctccgcttacgcccagctgctcgccgaccaggtgatcaacgtcggcgat
gaggtcgagttcgtggtcccgaccggcaacttcggcgatatcctcgccggctactatgcc
aagctgctcggtctgccggtcaagcacctcgtggtggcttccgacaagaacaacgtgctg
ttcgacttcctgaccaccggtacctacaaccgccagcgcccgttcttccagaccatctcc
ccctcgatggacatcctcatctcctccaacctggagcgcatgctgtactacttgtccgag
ggcgacacccgtctgatctccatgctgatgaacgacctcaacaagtggggcacgtacgag
atcccggaagaactgctggccaagattcgtcagatcttcggcaccggttgggccgatgag
gatcaggtacgcgagtccatcaaacactgctgggacgagcaccactacgtgatcgacccg
cacaccgcctgcggctactacctgcttgagcagatgccgcgcgacccgctgaccccgcgc
gtgctgctctccaccgccagcccctacaagttcccgcgcgtggtgaacgaggcattgggc
ttcgacgccaccggcaccgacttcgagtgcatggatgtgctggcccacgagaccggcacc
accgccccggccgccctgcgtggtcttgagaccgccgacgtgcggttcaaggacgtcgtg
gccatcgacggcatggaggactacgtggagaaggccgcccaggcgctgtga

DBGET integrated database retrieval system