KEGG   Bifidobacterium longum NCC2705: BL1036Help
Entry
BL1036            CDS       T00094                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00260  Glycine, serine and threonine metabolism
blo00750  Vitamin B6 metabolism
blo01100  Metabolic pathways
blo01110  Biosynthesis of secondary metabolites
blo01120  Microbial metabolism in diverse environments
blo01230  Biosynthesis of amino acids
Module
blo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL1036 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BL1036 (thrC)
Enzymes [BR:blo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BL1036 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 1022562
NCBI-ProteinID: NP_696205
UniProt: Q8G5H7
Position
861136..862626
Genome map
AA seq 496 aa AA seqDB search
MTTTFHSTRSTNDSLTAKQAIRKGIADDGGLFVSDALGKTKVDVASLPGKSYQQIAAEVL
GALLPDFTAEELGQCIADAYGEQWSDERITPLKPLGDDYVLELFNGPTSAFKDVALQILP
RFMAHTTPADGDADEKIMILTATSGDTGKAALAGFADAPGTAITVFYPEGKVSQVQELQM
TTQAGSNVQVAAVEGNFDDAQSAVKRIFGDRALAERLAGNSHVVLSSANSINVGRLVPQV
VYYFSAYAQLLADQVINVGDEVEFVVPTGNFGDILAGYYAKLLGLPVKHLVVASDKNNVL
FDFLTTGTYNRQRPFFQTISPSMDILISSNLERMLYYLSEGDTRLISMLMNDLNKWGTYE
IPEELLAKIRQIFGTGWADEDQVRESIKHCWDEHHYVIDPHTACGYYLLEQMPRDPLTPR
VLLSTASPYKFPRVVNEALGFDATGTDFECMDVLAHETGTTAPAALRGLETADVRFKDVV
AIDGMEDYVEKAAQAL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccaccttccattccacccgtagcaccaacgattcgctgaccgccaagcaggcg
attcgtaagggcatcgccgatgacggcggcctgttcgtttcggacgcgttgggcaagacc
aaggtggacgtggcctccctgccgggcaagtcgtaccagcagatcgccgccgaggtgctg
ggcgcgctgctgccggacttcacggccgaggagctgggccagtgcatcgccgacgcctac
ggcgaacagtggtccgatgagcgcatcaccccactcaagcccctgggtgacgattacgtg
ctcgaactgttcaacggtccgacttccgcgttcaaggacgtggcgctgcagatcctgccg
cgcttcatggcgcacaccacgccggccgatggcgacgcggacgagaagatcatgatcctc
accgccacctccggcgacaccggcaaggccgcgctggccggcttcgcggacgccccgggc
accgcgatcaccgtcttctacccggaaggcaaggtctcccaggtccaggaactgcagatg
accacgcaggccggctccaacgtgcaggtggccgccgtggaaggcaacttcgacgacgcc
cagtccgcggtcaagcgcatcttcggcgaccgtgccctggccgagcgtctcgccggcaat
tcgcacgtggtgctttcctccgccaactccatcaacgtgggccgtctggtgccgcaggtc
gtctactacttctccgcttacgcccagctgctcgccgaccaggtgatcaacgtcggcgat
gaggtcgagttcgtggtcccgaccggcaacttcggcgatatcctcgccggctactatgcc
aagctgctcggtctgccggtcaagcacctcgtggtggcttccgacaagaacaacgtgctg
ttcgacttcctgaccaccggtacctacaaccgccagcgcccgttcttccagaccatctcc
ccctcgatggacatcctcatctcctccaacctggagcgcatgctgtactacttgtccgag
ggcgacacccgtctgatctccatgctgatgaacgacctcaacaagtggggcacgtacgag
atcccggaagaactgctggccaagattcgtcagatcttcggcaccggttgggccgatgag
gatcaggtacgcgagtccatcaaacactgctgggacgagcaccactacgtgatcgacccg
cacaccgcctgcggctactacctgcttgagcagatgccgcgcgacccgctgaccccgcgc
gtgctgctctccaccgccagcccctacaagttcccgcgcgtggtgaacgaggcattgggc
ttcgacgccaccggcaccgacttcgagtgcatggatgtgctggcccacgagaccggcacc
accgccccggccgccctgcgtggtcttgagaccgccgacgtgcggttcaaggacgtcgtg
gccatcgacggcatggaggactacgtggagaaggccgcccaggcgctgtga

DBGET integrated database retrieval system