KEGG   Bifidobacterium longum NCC2705: BL1090Help
Entry
BL1090            CDS       T00094                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00010  Glycolysis / Gluconeogenesis
blo00071  Fatty acid degradation
blo00350  Tyrosine metabolism
blo00625  Chloroalkane and chloroalkene degradation
blo00626  Naphthalene degradation
blo01100  Metabolic pathways
blo01110  Biosynthesis of secondary metabolites
blo01120  Microbial metabolism in diverse environments
blo01130  Biosynthesis of antibiotics
blo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL1090
  Lipid metabolism
   00071 Fatty acid degradation
    BL1090
  Amino acid metabolism
   00350 Tyrosine metabolism
    BL1090
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BL1090
   00626 Naphthalene degradation
    BL1090
Enzymes [BR:blo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BL1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 1022631
NCBI-ProteinID: NP_696262
UniProt: Q8G5C4
Position
complement(924491..925534)
Genome map
AA seq 347 aa AA seqDB search
MSETMKAAIFVEPGKMTVEEVPKAMLEQDDDIVIRVVRTCVCGSDLWFFRGLSGQAAHSQ
VGHESIGVVEEVGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFESVCPHGGYFSACQAEY
LRVPEADGTVVKVPGSPEDYSDEQLASLLTISDVMSTGYHAAVSAEVKPGDTAVVMGDGA
VGLCGVIAAKMRGATRVIAMSRHEDRAALAREFGATDIVPERGQEAIDKVLEMTGGYGAD
AVLECVGSKQSFDTAIGLIRRGGVIGRVGLPHDVEISAEGTFYGNIGIKGGPAPVRHYDL
DEGLLDAVLKGEINPGRVFTAEYDLDHIQDAYEAMDQRKVIKALIRF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccatgaaagctgcgattttcgtggagcctggcaagatgaccgtggaagaa
gtgccgaaggcgatgcttgaacaggatgatgacatcgtgatccgcgtggtgcgcacgtgc
gtgtgcggctctgatttgtggttcttccgtgggctgagcggacaggccgcacacagccag
gtgggtcacgagtccatcggtgtggtcgaagaggttggcgcggcggtcgaatccgtcaag
cccggcgatttcgtggttgtgccattcccatacagctgcggcaagtgcccggtatgcaag
gccggcttcgaatccgtgtgcccgcacggcggctacttctccgcctgtcaggccgaatac
ctgcgtgtgcccgaggcggacggcaccgtggtcaaggtgcccggttcaccggaagattat
tccgatgagcagctcgcatcgctgctgaccatttccgatgtgatgtccaccggttatcac
gcggcggtttctgccgaggtcaagcccggtgacaccgccgtggtcatgggcgatggcgca
gttggcctgtgcggtgtgattgccgccaagatgcgcggtgccacgcgcgttattgccatg
agccgtcacgaggatcgcgcggcgctcgcccgcgaattcggtgcgactgatatcgtgccc
gagcgtggccaagaggctattgacaaggtgctggagatgaccggcggctatggtgcggac
gcagttctcgaatgcgtgggctccaagcagtccttcgacacggcgattggcctgattcgc
cgcggtggcgtgattggtcgtgtgggcctgccgcacgacgtggagatcagcgccgaaggc
acgttctacggcaacatcggcatcaagggcggcccggctcccgtgcgccactatgacctt
gatgagggtctgctggacgcggtgctcaagggcgagatcaaccccggccgcgtgttcacc
gccgagtacgacctcgaccatatccaggacgcctacgaggcgatggaccagcgcaaggtc
atcaaggcgctgatccggttctag

DBGET integrated database retrieval system