KEGG   Bifidobacterium longum NCC2705: BL1431Help
Entry
BL1431            CDS       T00094                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BL1431
Enzymes [BR:blo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BL1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
346498..347460
Genome map
AA seq 320 aa AA seqDB search
MPEPVRERLRALKDAPGSVIVVGSMNADYTVTTKRLPKPGETVNGGAMKVLPGGKGANQA
SAAARLGVNVQLLGAVGEDSNADFLLSKLDEAGVDTADILHVEGPSGTTVITVSAEGENT
IVYSPGSNAKASAGYVQSHRTTIAECAVLGLCLESPIATVIAAAQTAHDAGVTVLLNDSP
FMDELPHELVEATDILLVNQHEVAQLLGLPDDDVESLDWYEVAERFTDYGFDRAIVTLGA
SGSVVIENGRWHRVSAAQVNAVDTTGCGDSFMGTVLAGLAAGHTLLQSAQIGSYVSAYAA
TKLGAQSAYGTAEEVIAYFS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcccgtacgggagcgattgagagcgctgaaggatgcgccgggctcggtaatc
gtggtcggctcgatgaacgccgattacaccgtaaccactaaacgactacccaagccaggt
gaaaccgtcaatggtggtgccatgaaagtgctgccgggcggcaagggcgcgaatcaggca
tctgccgccgctcgtctcggtgtcaatgtccagttgctgggcgcggtgggcgaggactcc
aacgcggacttcctattaagcaagctggatgaggccggcgtcgacaccgccgatatcctg
catgtcgaaggccccagcggcaccacggtaatcaccgtgagcgctgagggcgagaacacc
atcgtctattcgccgggttccaatgccaaggcaagtgccggctatgtgcaatcacatcgc
acgaccatcgccgaatgcgcggtattgggactgtgtttggagagcccgattgccaccgtt
atcgccgccgcgcagaccgcgcatgacgctggcgtgaccgtgctgctcaacgactcgcca
tttatggacgagctgcctcacgaactggtggaagccacggatattctgctggtcaaccag
catgaagtggctcaactgctgggcctgccggatgatgacgtggaatcactcgactggtat
gaggtcgccgaacgattcaccgattacggattcgaccgggcgatagtgacgcttggtgcg
tcgggatcggtggtgatcgagaacggacgttggcatcgcgtatccgccgcgcaagtcaat
gcagtggacaccaccggttgcggcgactcgttcatggggaccgtgctggctggcttggcc
gccggtcatacgctgctgcaatccgcgcaaatcggctcctacgtctccgcctatgcggcc
accaagcttggtgcccaaagtgcctacggtaccgccgaagaagtcatcgcctacttcagc
tga

DBGET integrated database retrieval system