KEGG   Bifidobacterium longum NCC2705: BL1431Help
Entry
BL1431            CDS       T00094                                 

Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
blo00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BL1431
Enzymes [BR:blo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BL1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-GeneID: 1021584
NCBI-ProteinID: NP_696592
UniProt: Q8G4F5
Position
346498..347460
Genome map
AA seq 320 aa AA seqDB search
MPEPVRERLRALKDAPGSVIVVGSMNADYTVTTKRLPKPGETVNGGAMKVLPGGKGANQA
SAAARLGVNVQLLGAVGEDSNADFLLSKLDEAGVDTADILHVEGPSGTTVITVSAEGENT
IVYSPGSNAKASAGYVQSHRTTIAECAVLGLCLESPIATVIAAAQTAHDAGVTVLLNDSP
FMDELPHELVEATDILLVNQHEVAQLLGLPDDDVESLDWYEVAERFTDYGFDRAIVTLGA
SGSVVIENGRWHRVSAAQVNAVDTTGCGDSFMGTVLAGLAAGHTLLQSAQIGSYVSAYAA
TKLGAQSAYGTAEEVIAYFS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcccgtacgggagcgattgagagcgctgaaggatgcgccgggctcggtaatc
gtggtcggctcgatgaacgccgattacaccgtaaccactaaacgactacccaagccaggt
gaaaccgtcaatggtggtgccatgaaagtgctgccgggcggcaagggcgcgaatcaggca
tctgccgccgctcgtctcggtgtcaatgtccagttgctgggcgcggtgggcgaggactcc
aacgcggacttcctattaagcaagctggatgaggccggcgtcgacaccgccgatatcctg
catgtcgaaggccccagcggcaccacggtaatcaccgtgagcgctgagggcgagaacacc
atcgtctattcgccgggttccaatgccaaggcaagtgccggctatgtgcaatcacatcgc
acgaccatcgccgaatgcgcggtattgggactgtgtttggagagcccgattgccaccgtt
atcgccgccgcgcagaccgcgcatgacgctggcgtgaccgtgctgctcaacgactcgcca
tttatggacgagctgcctcacgaactggtggaagccacggatattctgctggtcaaccag
catgaagtggctcaactgctgggcctgccggatgatgacgtggaatcactcgactggtat
gaggtcgccgaacgattcaccgattacggattcgaccgggcgatagtgacgcttggtgcg
tcgggatcggtggtgatcgagaacggacgttggcatcgcgtatccgccgcgcaagtcaat
gcagtggacaccaccggttgcggcgactcgttcatggggaccgtgctggctggcttggcc
gccggtcatacgctgctgcaatccgcgcaaatcggctcctacgtctccgcctatgcggcc
accaagcttggtgcccaaagtgcctacggtaccgccgaagaagtcatcgcctacttcagc
tga

DBGET integrated database retrieval system