KEGG   Bifidobacterium longum NCC2705: BL1447Help
Entry
BL1447            CDS       T00094                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BL1447
   01230 Biosynthesis of amino acids
    BL1447
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL1447
  Energy metabolism
   00680 Methane metabolism
    BL1447
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL1447
Enzymes [BR:blo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BL1447
Exosome [BR:blo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BL1447
  Exosomal proteins of melanoma cells
   BL1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
368445..369290
Genome map
AA seq 281 aa AA seqDB search
MIDEVMMLRHGRTQYNLEHRLQGQIDVPLDIVGQWQVDQTGFALASRYYWAKVNRLAEHP
EAIAQPGPDAAERTDTRQFEEAPAAGRRMVVMTSDLFRAQQTAHAFADILGLPVTCDQRL
RERSFGEWEGMTRAEIKAVAADDYASWKQHTGGETKHGVESRAAVGQRGADAVRALVIDS
AYSDSTPTTLMLVTHGSWITATISNLLELDPDGMNALGGMRNACWCRLKVRHSVNGTPTE
QPLWELEEYNKAPAIADSADWENGPTDLRGPHMPSWQPIVW
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgatgctgcgtcatggccgtacgcaatacaatctcgaacatcgc
ttgcaaggccagatcgatgtgccgctcgacatcgtaggccaatggcaggttgaccagacc
ggattcgcgctcgcttcacggtattactgggccaaggtgaaccgacttgccgagcatccc
gaagccatcgcccagcccggtcctgacgccgccgaacgcactgatacgcgccagttcgag
gaggctcccgccgccggccggcgcatggtggtgatgacctccgacctgttccgtgcccaa
cagaccgcacacgccttcgccgatattttgggattgccagtcacctgtgaccaacgactg
cgtgaacgcagcttcggcgagtgggaaggcatgacccgcgccgaaatcaaagccgtggca
gccgacgactacgcctcttggaaacagcacactgggggcgaaaccaagcatggtgtggaa
agccgtgccgccgtgggccagcgaggtgccgatgccgtgcgcgcactggtcatcgactcc
gcctattcagacagcacgcccaccacgctgatgctcgtcacccatggctcatggattacc
gccaccatctccaacctgctcgaactcgacccggacggcatgaacgcactcggcggcatg
cgcaacgcctgttggtgccggctcaaagtgcgccacagcgtcaacggcacccccaccgaa
cagccactgtgggagttggaggaatacaacaaggctcccgccatcgccgacagcgccgac
tgggagaacgggccgaccgatctgcgaggaccgcacatgccaagttggcagccaatcgtc
tggtga

DBGET integrated database retrieval system