KEGG   Bifidobacterium longum NCC2705: BL1526Help
Entry
BL1526            CDS       T00094                                 

Gene name
agl
Definition
oligo-1,6-glucosidase
Orthology
K01182  
oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:blo00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1701071..1702891
Genome map
AA seq 606 aa AA seqDB search
MTTSQRTVIPDSIRTNGATPNPWWSNAVVYQIYPRSFQDTNGDGLGDLKGITSRLDYLAD
LGVDVLWLSPVYKSPQDDNGYDISDYQDIDPLFGTLDDMDELLAEAHKRGLKIVMDLVVN
HTSDEHAWFEASKNKDDEHADWYWWRPARPGTTAGEPGAEPNQWGSYFGGSAWEYCPERG
EYYLHQFSKKQPDLNWENPAVRRAVYDMMNWWLDRGVDGFRMDVITLISKRTDLSGKLPG
EYGSELDDLPVGEEGYSNPNPFCADGPRQDEFLAEMRREVFEGREGFLTVGEAPGVTAQR
NEYITDPANGELDMLFLFEHVDFDCEGVKWKPLPLDLPKLKSIMAGYQAAVKNAGWASLF
TGNHDQPRVVSRWGDDSSEESRVRSAKALGLMLHMHRGTPYIYQGEELGMTDAHFTRLDQ
YRDLESLNAYRQRVEEAKVQSPESMLAGIAARGRDNSRTPMQWDGSVYAGFTAPDAAKEP
WISVNPNHAAINAVGEFDDPDSVYAFYKQLIALRHDMPVVAAGDWHLLDADDAHVYAFTR
TLGDEKLLVVVNMSGRTVDLPRETAELAAAGITESNVVISTYDAPHAVASLANRELDPWE
AAVIQL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttcacaacgcacagtaattccagattccatccgcaccaacggtgccacccca
aatccgtggtggtccaatgcggtcgtttaccagatttacccgcgttccttccaagacacc
aacggcgacggcctcggcgatctcaagggcattacgtcacggctcgactatctggccgac
ctcggcgtggatgtgctgtggctatccccggtatacaagtctccgcaagacgataatggc
tacgatatttccgactatcaggacattgatcctctgttcggcacactcgacgacatggat
gagctgctggccgaggcccacaagcgcgggctcaagatcgtgatggatcttgttgtcaat
cacacttccgatgaacacgcctggtttgaagcgtccaaaaacaaggatgatgagcacgcc
gactggtattggtggcgtcccgcccgtcccggcaccactgccggcgagcccggtgccgag
cccaaccagtggggctcctactttggcggttctgcatgggagtattgccctgagcgtggc
gaatactacctgcatcagttctcgaagaagcagccggacctcaactgggaaaatccggct
gtgcgccgcgcggtatacgacatgatgaactggtggcttgaccgcggcgttgacggcttc
cgcatggatgtgattacgctgatttccaagcgcacggacctgtctggcaagctgcccggc
gagtacggttccgagctggacgatctgcccgtgggtgaggaaggctattccaacccgaat
ccgttctgcgcggacggccctcgccaagacgaattcctggccgaaatgcgccgtgaagtg
ttcgaaggccgtgagggcttcctcaccgtgggcgaggctcccggcgttaccgcacagcgc
aacgaatacatcaccgaccccgccaacggcgagctggacatgctcttcctattcgagcac
gttgattttgactgcgaaggcgtcaaatggaagccactgccacttgacctgccgaagctc
aagagcattatggccggttatcaagcggccgtgaagaatgcaggctgggcaagcctgttt
actggtaaccacgaccagcctcgcgtcgtttctcgttggggtgatgactcctcggaggaa
tctcgtgtgcgttcggccaaggcacttggcctgatgctgcacatgcatcgcggcaccccg
tacatatatcagggcgaagagctaggcatgaccgacgcccacttcacgcgcctagaccag
taccgtgacctcgagtccctgaacgcttaccgtcaaagggttgaggaagccaaagtgcag
tcgcccgaatcgatgttggcgggtatcgccgcgcgcggtcgtgataattcgcgtaccccg
atgcaatgggacggctctgtctatgccggtttcactgcgccggatgccgctaaggagcca
tggatctccgtcaatcccaaccatgcggcgatcaacgcggtcggcgaattcgacgatccg
gattcggtatatgccttctacaagcagctcatcgcgctgcgccacgacatgcctgtcgtg
gcggccggcgactggcatctgctcgatgcggatgacgcgcatgtctacgccttcacccgc
accctcggcgatgagaagctgctggtcgtggtcaacatgtccggccgaaccgttgatcta
ccgcgcgaaaccgccgaactggccgccgccggaatcaccgagtcgaacgtggtaatcagc
acgtatgatgccccgcacgccgtggcctccctcgccaaccgtgagctcgatccttgggag
gccgccgtcattcagctgtag

DBGET integrated database retrieval system