KEGG   Bifidobacterium longum NCC2705: BL1570Help
Entry
BL1570            CDS       T00094                                 

Gene name
malQ1
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BL1570 (malQ1)
Enzymes [BR:blo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BL1570 (malQ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1983830..1985995
Genome map
AA seq 721 aa AA seqDB search
MSEITESEERLARPLIRLAKLVGVGTSYLGMSHDYHEIDDDVLIEVLAALGIDASSESAQ
LIAIRRILNERYARLVAPTVLHIAGSEDRVLVNTGILDVPSASITLENGEPYQGTIEVGP
GDGSQAYDLDGTFISNAAVVIPADLPIGYHTLHVKVADRVQDATLISAPDRVDLLDPMKG
GSLWGWMAQLYSIRSSNSWGVGDYEDLKTMLVDAKQKTGADFVLINPVHAAEPVSPLTPS
PYLPVSRRLINFTYIRPEAIAEYATLSEGDKNAVDGLHADTEPLNGDSQLIDRDAMWRSK
MHALWIIFKAGRTAERQSVFDQFKADCGSDLEAYATWCLCYDKWGAPNGEEGNWERKFNR
NSPEIANLRKQYPDTLDFYRWLEWIAAEQLSSAQQAAKDAGMHIGIMSDMAVGVHPSGAD
VWWNPERFAKGATVGAPPDMFNQQGQNWSQPPLSPINLETTGYEAYRNMVHGMFARAGAV
RIDHILGLFRLWWIPENRSAMDGAYVYYDSDIMLGVLAIEASRAGGVVVGEDLGVVPDHV
ADSLSSHGILGCAVEWFEQCDGVFRAPSQWRPYALASVNTHDLPPAAGYLEYEHVKIRER
LGLLTGPAEEFEASAKAEQDAMLAMLVEQGYLDADFAEHREDHEADIVDALYRALKGSPC
KLLAASITDAVGEKRAQNQPGTNNEYPNWRIPLADAKGNVVPLETLFDTPGAQRFAQIFN
S
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagattaccgagagtgaagagcgtctggcccgtccgttgattcgactggccaag
ttggtcggtgtcggcacgagttatttgggcatgagccatgactaccacgagatagacgat
gacgtcctgatcgaggtgctggcagcgctgggcatcgacgcctccagcgagagcgcccaa
ctcatcgccatccgacgcattctgaacgagcgttacgcccgattggtggcacccaccgtg
ctgcatatcgccggtagcgaggaccgggtgctggtgaacaccggtattctggacgtgcct
tcggcgagcatcacgctggagaatggcgagccatatcaaggcaccattgaagttggtcct
ggagatggatcccaggcctacgacttggatggtacgttcatttcgaatgcggctgtggtc
attcccgccgatctgccgattggttaccatacgctgcacgtcaaggtcgccgaccgtgtg
caagacgccactttgatcagtgcacctgatcgcgtcgatctgcttgacccgatgaagggc
ggcagtctgtggggctggatggcccagctgtactcgattcgctcctccaactcctggggc
gtgggcgattacgaggatctgaagaccatgctggtggacgccaagcagaagaccggtgcc
gacttcgtgctcattaatccggtgcatgccgccgagccggtgtccccgctcaccccgtcg
ccgtatctgccggtaagccgtcgcctgatcaacttcacgtacatccgtcctgaggcgatc
gccgaatatgccacgctcagcgagggcgacaagaatgccgtcgacggactgcatgccgac
accgaaccgctgaacggtgattcccagctcatcgaccgtgacgccatgtggcgcagcaag
atgcacgccctgtggattatcttcaaggccggccgtaccgccgaacgccaaagcgtattc
gaccaattcaaggcggactgtggttccgacttggaggcgtatgccacgtggtgcctgtgc
tacgacaagtggggggcgcccaacggcgaggagggcaactgggagcgcaagttcaatcgc
aactccccggaaatcgccaatctgcgcaagcagtacccggacactttggacttctaccgc
tggctggaatggattgccgccgagcagctgtcctccgcccaacaggcagccaaggacgcc
ggcatgcatatcggcatcatgtccgatatggccgtcggcgtgcacccctccggcgctgac
gtgtggtggaatcccgagcgcttcgccaagggagccacggtcggcgcaccgccggacatg
ttcaaccagcaaggccagaactggagccagccgccgctgagcccgatcaatctggagacc
accggctacgaggcctaccgcaatatggtgcatggcatgttcgcccgtgccggtgcggtg
cgcatcgatcacatccttggtctgttccgcctgtggtggattcccgagaaccgttcggct
atggatggcgcttacgtgtactacgactcagacatcatgctgggcgttctggccatcgag
gcctctcgtgccggcggcgtggtcgtaggtgaggacctcggcgtggtgccggaccatgtg
gccgattccctgtcgagccacggtattctcggttgcgccgttgaatggttcgagcagtgc
gacggcgtgttccgcgccccctcccagtggcgtccgtatgcattggcctccgtgaatacg
cacgatttgccgccggccgccggttacctggaatacgagcacgtcaagattcgtgagcgt
ctgggcttgctgaccggcccggccgaggaattcgaagcctccgccaaggccgagcaggat
gcgatgctggccatgctggtcgagcagggttatcttgatgccgactttgccgaacatcgt
gaggatcacgaggcggatatcgtcgacgcgctgtaccgcgcactgaagggttcgccgtgc
aagctgctcgccgcctcgatcaccgacgcggtgggggagaagcgtgcgcagaaccagccg
ggcaccaacaacgaatacccgaactggcgcatcccactggccgacgccaagggcaacgtg
gtaccgctcgaaaccctcttcgacacccccggtgcccaacgcttcgcccaaatcttcaat
tcctga

DBGET integrated database retrieval system