KEGG   Bifidobacterium longum NCC2705: BL1575Help
Entry
BL1575            CDS       T00094                                 

Gene name
adh2
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BL1575 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL1575 (adh2)
   00620 Pyruvate metabolism
    BL1575 (adh2)
   00650 Butanoate metabolism
    BL1575 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    BL1575 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BL1575 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BL1575 (adh2)
   00626 Naphthalene degradation
    BL1575 (adh2)
Enzymes [BR:blo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BL1575 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BL1575 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1991692..1994421
Genome map
AA seq 909 aa AA seqDB search
MAEAKKKVEATKPTPEEKQAAAEAEVDALVARAKKALVEFENLDQKQVDRIVAKASIAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTNYLAGQKTVGIIREDDVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQKCSVEAAKIVRDAAIEAGAP
ENCIQWIEHPSIQATGALMKHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVDS
DVDIVRAANDLVLSKHFDYGMICATEQAIIAHKDVYDQLIKELKVRKAYFVNAEEKAKLE
QYMFGCTAGSGVKPVLNSAVPGKSPQFIAKAAGFEIPSDATILAAECKEVSDDEPLTHEK
LAPVQAVLKADNKEQAFEMCEKMLKLGAGHTAAIHTNNQELVREYGVRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLVNIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKIIDQLRARSNRVTFRIIDYVEPEPSV
ETVEKGAEMMREEFEPDTIIAVGGGSPMDASKIMWLLYEHPEIAFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLVKTNA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGQIPEEP
TSWPKYNKYIAPERYQDIARNLGIDTGKTPAEAVENLAKAVEDYRDNKLGMNKSFQDCGV
DEDYFWSVLDQIGMRAYEDQCTPANPRIPLINDMKDIAVGAYYGVSQAEGHKLRIEREGE
AATEEASER
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaagcaaagaagaaggtcgaagctaccaagccgactccagaagagaagcaggcc
gcagctgaggccgaagttgacgcgctggttgcccgcgccaagaaggctctcgtcgaattc
gagaacctcgaccagaagcaagttgatcgtatcgtcgccaaggcctccatcgccgctctg
aacaagcacctcgttctcgccaagatggctgtcgacgagaccggccgtggtctcgtggaa
gacaaggccaccaagaacatcttcgcctgcgagcacgtcaccaactacttggccggccag
aagaccgtcggcatcatccgcgaagacgatgtgatgggcatcgatgaggtcgccgagccc
gtcggcgtggtcgccggcgtcaccccggtcaccaacccgacctccaccgccatcttcaag
tccctcatcgccctgaagacccgttgcccgatcgtcttcggcttccaccccggcgcgcag
aagtgctccgtcgaggccgccaagattgtgcgcgacgccgccatcgaagccggtgctccc
gagaactgtatccagtggatcgagcacccgtccatccaggccacaggcgccctgatgaag
catccgggcgtggccacgatcctcgccaccggtggtccgggcatggtcaaggccgcttac
tcctccggcaagcccgccctcggcgtgggtgccggcaacgccccggcctatgttgattcc
gatgtggacatcgtgcgcgccgccaacgatctggtgctctccaagcacttcgattacggc
atgatctgcgccaccgagcaggccatcatcgcccacaaggacgtctacgaccagctcatc
aaggagctcaaggtccgtaaggcctacttcgtcaacgccgaagagaaggccaagctggaa
cagtacatgttcggctgcactgccggttccggcgtcaagcccgtgctgaactccgcggtg
ccaggcaagtccccgcagttcatcgccaaggctgctggcttcgagattccgtccgacgcc
accattctggccgccgagtgcaaggaagtctccgacgacgagcctctgacccacgagaag
ctcgctccggtgcaggccgtgctcaaggccgacaacaaggagcaggccttcgagatgtgc
gagaagatgctcaagctgggtgccggccacaccgccgccatccacaccaacaaccaggag
ctcgtgcgtgagtacggcgtccgtatgcacgcctgccgcatcatctggaaccagccttcc
tcccttggcggcatcggcgacatctacaacgccatcgccccgtcgctgaccctgggctgc
ggctcctacggcggcaactcggtgtccggcaacgtgcaggccgtgaatctcgttaacatc
aagcgcattgctcggaggaacaacaacatgcagtggttcaagatcccggccaagacctac
ttcgagccgaacgccatcaagtacctgcgcgacatgtacggcatcgagaaggccgtcatc
gtgtgcgataaggtcatggagcagctcggcattgttgacaagatcatcgaccagctgcgc
gcccgctctaaccgtgtgaccttccgcatcatcgactacgtcgagccggagccctccgtc
gagaccgtcgaaaagggcgctgagatgatgcgcgaggagttcgagccggacacgatcatc
gcggttggcggcggctccccgatggatgcctccaagattatgtggctgctctacgagcac
ccggaaatcgccttctccgacgtgcgcgagaagttcttcgatatccgtaagcgcgccttc
aagatcccgccgctgggcaagaaggccaagctggtgtgcatcccgacctcctccggcacc
ggttccgaggtcaccccgttcgccgtgatcaccgatcacaagaccggctacaagtacccg
atcaccgactacgcgctgaccccgtccgtggccatcgtggacccggtgctggctcgcacc
cagccgcgcaagctggcctccgacgccggcttcgacgccctgacccactcgatggaagcc
tacgtgtccgtgtacgcgaacgacttcaccgacggcatggccctgcacgcggccaagctc
atctgggacaacctggctgagtccgtcaatggcgagcccggcctggtcaagaccaacgct
caggagaagatgcacaacgccgccaccatggccggcatggcattcggctccgcgttcctc
ggcatgtgccacggcatggcccacaccatcggtgccctgtgccacatcgcccacggccgt
accaactccatcctgctgccgtacgtgattcgttacaacggccagattcctgaggagccc
acttcttggccgaagtacaacaagtacatcgccccggaacgctaccaggatatcgcccgc
aacctcggcatcgacaccggcaagaccccggccgaagccgtggagaacctggcgaaggcc
gtcgaggactaccgtgacaacaagctcggcatgaacaagagcttccaggattgcggtgtg
gacgaggactacttctggtccgtgctcgatcagatcggcatgcgcgcctacgaggaccag
tgcaccccggccaacccgcgcatcccgctgatcaacgacatgaaggacatcgccgtcggt
gcttactacggtgtctcccaggcggaaggccacaagctgcgcatcgagcgcgagggtgag
gccgccactgaggaagcctccgagcgttga

DBGET integrated database retrieval system