KEGG   Bifidobacterium longum NCC2705: BL1656Help
Entry
BL1656            CDS       T00094                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BL1656 (gpmA)
   01230 Biosynthesis of amino acids
    BL1656 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL1656 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BL1656 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BL1656 (gpmA)
Enzymes [BR:blo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BL1656 (gpmA)
Exosome [BR:blo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BL1656 (gpmA)
  Exosomal proteins of melanoma cells
   BL1656 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2071657..2072427
Genome map
AA seq 256 aa AA seqDB search
MGARGCRLNRMTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVL
PDIVFTSLLRRAINTANIALDAADRLWIPVQRDWRLNERHYGALQGKNKTEIREEYGDEK
FMLWRRSYATPPPEIDPNDQYAQNNDPRYAGDPVPEAECLANVVERVKPYFESAIEPELK
AGKTVLIAAHGNSLRAIVKMLDNLSEEEIAKVNIPTAIPLLYELDENFKPIKPRGEYLDP
EAAAAGAAAVAAQGQK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
ttgggcgcacgcggctgtagactgaaccgtatgacttataaactagtactgctccgtcat
ggacagagcgcatggaataaaactaaccagttcaccggctgggtcgacgtaccgctgacc
gagcagggtgaagccgaagccaagcgtggcggcgagctgctcaaggagaagaacgtcctt
ccggacatcgtgttcacctccctgctgcgtcgcgccatcaacaccgccaacatcgctctg
gatgccgcagatcgtctgtggattccggttcagcgtgactggcgtctcaacgagcgtcac
tacggcgctctgcagggcaagaacaagaccgagatccgcgaagagtacggcgacgagaag
ttcatgctgtggcgccgttcttacgccaccccgccgcccgagatcgacccgaacgaccag
tacgcccagaacaacgacccgcgctacgccggcgatccggttccggaagccgagtgcctg
gccaacgttgttgagcgtgtgaagccgtacttcgagtccgctatcgagccggagctcaag
gccggcaagaccgtgctgattgctgcccacggcaactccctccgcgccatcgtcaagatg
ctggacaacctgtctgaggaagagatcgccaaggtcaacatcccgaccgccatcccgctg
ctctacgagctggacgagaacttcaagccgatcaagccgcgtggcgagtacctggacccg
gaggctgctgctgccggtgccgccgctgtcgccgctcagggccagaagtga

DBGET integrated database retrieval system