KEGG   Bifidobacterium longum NCC2705: BL1685Help
Entry
BL1685            CDS       T00094                                 

Gene name
sulD
Definition
SulD
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BL1685 (sulD)
Enzymes [BR:blo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BL1685 (sulD)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     BL1685 (sulD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2105412..2106824
Genome map
AA seq 470 aa AA seqDB search
MDTITLTGVHANGTHGVLAFEHERPQTFVVDVTLHLDLAAAGQSDDLNDTIDYGRVAKDI
VAVIEGPHVDLIERLAQRIADKILADAPAVASIDVTVHKPHAPIVVAFADVSVSISRVRA
TDNGRTAEKHAIHNAVVALGGNVGEVESTLRAAVREIDALLGTQVTGISPLYRTAAWGMA
DGTPDFLNAVVELGTTMGRHELLAALQNIEANHGRIRENHWDSRPLDLDIIDFDGITSAD
PDLALPHPRAWQRAFVLAPWLALNPNAKLAGAHEGPVADLLAAAPDRNAVQLESEDWMLG
GHAVKQKSASESAPVSRKAIISLDSTSQDAERLFRETIVSIDSVPGNQVQGISPLYHVSH
FDSPDAMSAVIQIETKLPPADLIAVLGSIESVHDLAVDLDLVDMEGVTSDEPNCSIPWPS
ARNHASVLAPWLDMDPNASLGGDPVAFLLAMAPDAGQVGLLSDNWILSNS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatcacacttaccggcgtacatgccaacggcacccacggtgtgctcgccttt
gaacacgaacggccacaaaccttcgtcgtggacgtcaccctgcaccttgatctggccgcc
gccggccaatccgacgatctcaatgacaccatcgattacggccgcgtggccaaggatatc
gtggctgtcatcgaaggccctcatgtggacctgatcgagcgtctggcccaacgtatcgcg
gataagattcttgccgatgcgccggccgtcgcctccatcgacgtcaccgtgcacaagcct
cacgcgcccatcgtcgtggcttttgcagatgtatcggtctccatctcgcgcgtgcgtgcc
accgataatggacgcactgctgaaaagcatgccatccataacgcggtggtggccttgggg
ggcaatgtgggcgaggtggaatccaccttgcgagccgccgttcgggagattgacgcgctg
cttggcacacaggtgaccggtatttcgccgctttaccgcacggccgcgtggggcatggct
gacggtacgccggatttcctgaacgccgtggtggagcttggaaccacaatgggccgccac
gaattgctcgccgcgttgcaaaacatcgaagcgaaccatgggcgaattcgtgagaatcat
tgggattccaggccgttggacttggacattatcgactttgatggcatcaccagcgcggat
ccggatctggcattgccccatccgcgtgcttggcagcgcgcatttgtgctggctccttgg
ttggcattgaatccgaacgccaaactcgccggagcccatgaggggcctgtagccgatttg
ctggccgccgcaccggaccgtaacgccgtgcagctcgagagcgaagactggatgctcggc
gggcatgcagtcaagcaaaaatcagcgtcggagtcggcacccgtctcacgcaaggcgatt
atttcgctggattccacctcgcaggatgccgaacggctgttccgcgaaaccatcgtttcc
atcgacagtgttcctggcaatcaggtacagggcatctcgccgctctaccatgtcagccat
ttcgacagtccggacgcgatgagcgcggtcatccaaatcgaaaccaagttgccgcccgcc
gacctgattgccgtattgggcagcatcgaaagtgttcatgatctggcagtcgaccttgac
cttgttgacatggaaggcgtgacttccgacgagcccaactgcagcattccttggccgtcg
gcccgtaaccatgcgtcggtattggcaccttggctggatatggacccgaatgcttctctg
ggcggcgacccggtggccttccttttggccatggcaccggatgctggacaggtcggattg
ctatcggacaactggatactgtcgaatagttga

DBGET integrated database retrieval system