KEGG   Bifidobacterium longum NCC2705: BL1772Help
Entry
BL1772            CDS       T00094                                 

Gene name
rbsK
Definition
PfkB family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
blo  Bifidobacterium longum NCC2705
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BL1772 (rbsK)
Enzymes [BR:blo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BL1772 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2205363..2206331
Genome map
AA seq 322 aa AA seqDB search
MSASCLDLLDHLHGSVSVVGSMNVDYTVVTERLPKPGETVNGGPLTLLPGGKSANQASAA
ARIGAQVRMFGAVGEDTNADFLLEHLRDAGVDTSHIAAVAGPSGTTVITVDANGENTIVY
SAGSNGEVSVDYVQQSSDALVAADVLGLCLESPMETVTACARLCHDAGLKVLLNDSPFVA
ELPAELIEASDILLVNEHEMAQLLDIAEPDDDDWDGLDWSDVARQMHDFGFNQAIITLGG
DGSVVIDGDDIYRIAPVAVEAIDTTGCGDAFMGTVLAGLASGHALADSAQLASYVSAYAA
TGFGAQASYGTAAQIRERFGAK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcatcatgtcttgacttgctcgaccacctgcacggcagtgtgtccgtggtcgga
tcaatgaatgttgattacacggtcgttactgagcggttgccgaaaccgggagagaccgtc
aacggtggcccgctgaccttattgccgggaggcaagtcagcgaatcaggcatcggcggct
gcgcgaattggagcgcaggtgcggatgtttggtgcagtcggggaagataccaatgcggat
tttctgctggagcatttgcgcgatgctggtgtggatacttcgcatatcgctgccgttgca
ggtcccagtggcactacggtaattaccgtggacgcgaatggcgagaacaccatcgtatat
tcggctggttccaatggtgaggtatctgtcgactatgtgcagcagtcatctgatgcattg
gttgctgctgatgtactgggactgtgtttggaaagtccgatggaaacggtcacggcatgc
gctcgcctctgtcatgatgccgggctcaaggtattgctcaacgattcgccattcgttgct
gaactacccgctgaacttatcgaggcttcggacattctgctggtcaatgaacatgaaatg
gcacagctgctggacatcgccgagcctgacgatgacgattgggatggactggactggtct
gatgtggcgcggcagatgcatgacttcggttttaatcaggcgataattacgcttggcggg
gatgggtcggtagtcatcgatggtgatgatatctatcgtattgcgccagttgcggttgag
gccatcgacactaccgggtgcggagatgcctttatgggcacggttctggccgggcttgcc
tcgggtcatgcgttggcggacagtgcgcagttggcctcatacgtttccgcgtacgccgcg
actgggttcggcgcgcaagcctcttatggtactgccgctcagattcgtgagcggtttggt
gcgaagtaa

DBGET integrated database retrieval system