KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0084Help
Entry
BLIJ_0084         CDS       T02092                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BLIJ_0084
Enzymes [BR:blon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BLIJ_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101644..102744
Genome map
AA seq 366 aa AA seqDB search
MGTMQVTMIDENKYAEMMADVVLPALEQCREEGWFDPSAAERSAGVEPLSGIMDTGGRSG
QLHYLCYDSAKFDAIREQGATAVFRGAIVISHGFTEFAEKYDELVWYFLLAGYSVCVLEH
RGHGKSARDVDDHCMVWIDDWRRYVADLAGFAETIGQQYAAGMPLNLFCHSMGGGIGAAL
LERYPALFDKAVLSAPMIAPATGMPLGVARVLVNALCGLGFGKKRVFGQSDFTPEFSMKG
NEGASEARERWYFRLRCENREYQTYCATFEWVRQALKLNRAVLRPSACAEVETPVMLFQA
GRDVWVLNKPQNRFIQLVKDGGGEADLVRFPESRHEIFSMPNSTYKPYLEKILGFYDDPT
IASATY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccatgcaggtgacgatgatcgacgaaaacaagtacgccgaaatgatggccgac
gtggtgctgcccgcgctcgaacaatgccgcgaggagggctggttcgatccgtccgccgcc
gaacgttcggccggggtcgagccgctgtccggcattatggacaccggcggccgctcgggc
cagctgcactacctgtgctacgattccgccaaattcgacgcgattcgcgaacaaggcgcc
accgccgtcttccgcggggccatcgtcatcagccacggcttcaccgagttcgccgagaag
tacgacgaactggtctggtacttcctgctcgccggctattcggtgtgcgtgctcgaacat
cgcggccacggcaagtccgcgcgcgacgtggacgatcattgcatggtgtggatcgatgat
tggcggcgctacgtggccgatctggccggcttcgccgaaaccatcggccagcagtacgcg
gccggcatgccgctgaacctgttctgccattcgatgggcggcggcatcggcgcggccctg
ctcgaacgctaccccgccctgttcgacaaggcggtgctctccgcccccatgatcgccccc
gccaccggcatgccgttgggtgtggcccgtgtgctggtcaatgcgctgtgcggactcggc
ttcggcaagaagcgcgtgttcgggcagtcggacttcacgccggaattctccatgaaaggc
aacgagggcgcgtccgaggcgcgtgaacgctggtatttcagactgcgttgcgaaaaccgt
gaataccagacctactgcgcgacgttcgaatgggtgcgtcaggcgctcaagctcaaccgg
gccgtgctgcgcccgtccgcctgcgccgaagtggagacgccggtgatgctcttccaggcc
ggccgagacgtgtgggtgctcaacaaaccgcagaaccgtttcatccaactggtcaaggac
ggcggcggcgaggccgatctcgtgcggttccccgaatcacgccacgagatcttctccatg
cccaacagcacctacaagccctacctcgaaaagatccttggcttctacgacgatccgacg
atcgccagcgccacgtactga

  All links  
No link information was found.   
DBGET integrated database retrieval system