KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0084Help
Entry
BLIJ_0084         CDS       T02092                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:blon00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101644..102744
Genome map
AA seq 366 aa AA seqDB search
MGTMQVTMIDENKYAEMMADVVLPALEQCREEGWFDPSAAERSAGVEPLSGIMDTGGRSG
QLHYLCYDSAKFDAIREQGATAVFRGAIVISHGFTEFAEKYDELVWYFLLAGYSVCVLEH
RGHGKSARDVDDHCMVWIDDWRRYVADLAGFAETIGQQYAAGMPLNLFCHSMGGGIGAAL
LERYPALFDKAVLSAPMIAPATGMPLGVARVLVNALCGLGFGKKRVFGQSDFTPEFSMKG
NEGASEARERWYFRLRCENREYQTYCATFEWVRQALKLNRAVLRPSACAEVETPVMLFQA
GRDVWVLNKPQNRFIQLVKDGGGEADLVRFPESRHEIFSMPNSTYKPYLEKILGFYDDPT
IASATY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccatgcaggtgacgatgatcgacgaaaacaagtacgccgaaatgatggccgac
gtggtgctgcccgcgctcgaacaatgccgcgaggagggctggttcgatccgtccgccgcc
gaacgttcggccggggtcgagccgctgtccggcattatggacaccggcggccgctcgggc
cagctgcactacctgtgctacgattccgccaaattcgacgcgattcgcgaacaaggcgcc
accgccgtcttccgcggggccatcgtcatcagccacggcttcaccgagttcgccgagaag
tacgacgaactggtctggtacttcctgctcgccggctattcggtgtgcgtgctcgaacat
cgcggccacggcaagtccgcgcgcgacgtggacgatcattgcatggtgtggatcgatgat
tggcggcgctacgtggccgatctggccggcttcgccgaaaccatcggccagcagtacgcg
gccggcatgccgctgaacctgttctgccattcgatgggcggcggcatcggcgcggccctg
ctcgaacgctaccccgccctgttcgacaaggcggtgctctccgcccccatgatcgccccc
gccaccggcatgccgttgggtgtggcccgtgtgctggtcaatgcgctgtgcggactcggc
ttcggcaagaagcgcgtgttcgggcagtcggacttcacgccggaattctccatgaaaggc
aacgagggcgcgtccgaggcgcgtgaacgctggtatttcagactgcgttgcgaaaaccgt
gaataccagacctactgcgcgacgttcgaatgggtgcgtcaggcgctcaagctcaaccgg
gccgtgctgcgcccgtccgcctgcgccgaagtggagacgccggtgatgctcttccaggcc
ggccgagacgtgtgggtgctcaacaaaccgcagaaccgtttcatccaactggtcaaggac
ggcggcggcgaggccgatctcgtgcggttccccgaatcacgccacgagatcttctccatg
cccaacagcacctacaagccctacctcgaaaagatccttggcttctacgacgatccgacg
atcgccagcgccacgtactga

DBGET integrated database retrieval system