KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0129Help
Entry
BLIJ_0129         CDS       T02092                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blon00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149920..151446
Genome map
AA seq 508 aa AA seqDB search
MKNKVQLIAYADRLGDGTLSSMTDILRTRFDGVYDGVHILPFFTPFDGADAGFDPIDHTK
VDPRLGSWDDVAELSKTHGIMVDAIVNHMSWESKQFQDVLEKGEESEYYPMFLTMSSVFP
NGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSDKGWEYLMSIFDQ
MAASHVSYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEGVKRGLEILIEVHSYYKKQ
VEIASKVDRVYDFALPPLLLHSLFTGHVEPVVHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDSLVNTIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YLAARAVQFFLPGVPQVYYVGALAGRNDMELLRKTNNGRDINRHYYSTAEIDENLERPVV
KALNALAKFRNELPAFNGEFSYEADGDTSITFRWIAADGKTKAALIFEPGRGLGTDNTTP
VASLAWTDAAGDHETDDLLSNPPIVDID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagtgcagctcattgcttacgccgatcgtctcggcgatggcactcttagc
tcgatgaccgacatcctgcgcacccgcttcgacggcgtgtatgacggcgtgcatatcctg
ccgttcttcactccgttcgatggtgcggatgcaggcttcgacccgatcgaccacaccaaa
gtcgacccgcgtctcggcagctgggacgacgtcgctgaactttccaagacccacggcatc
atggtcgatgccatcgtcaaccacatgagctgggaatccaagcagttccaagacgtgctt
gaaaaaggtgaggaatccgagtattacccgatgtttctgaccatgagctccgtcttcccg
aacggcgccaccgaagaggatctggccggcatttaccgcccgcgcccgggcctgccgttc
acccactacaagttcgccggcaagacccgcctggtctgggtcagcttcaccccgcagcag
gtggacatcgacaccgattccgacaagggctgggaatacctcatgtccatcttcgatcag
atggccgcatcccacgtcagctacatccgtctcgacgccgtgggctacggcgccaaggag
gccggcaccagctgcttcatgacccccaagacctttaagctcatctcacgcctacgcgag
gaaggcgtcaagcgaggcctcgaaattctcattgaggtgcatagctactacaagaagcag
gttgaaatcgcctccaaggtggaccgcgtctacgacttcgccctgcctccgctgctcctg
cactcgctgttcaccggtcacgtggaacccgtggtccactggaccgaaatccgcccgaac
aacgccgtcaccgtgctcgatacgcacgacggcatcggcgtgatcgacatcggctccgat
cagctcgaccgcagcctcaagggcctcgtgcccgacgaggacgtcgatagtctggtcaac
accatccacgccaacacccacggcgaatcccaggccgccaccggtgccgccgccagcaac
ctcgacctctatcaggtcaacagcacgtactactccgcgctcggctgcaacgaccagcac
tatctggccgcccgcgcagtccagttcttcctgcccggagtgccgcaggtctactacgtg
ggcgcgctcgccggccgcaacgacatggaactgctgcgcaagaccaacaacggccgtgac
atcaatcgccattactactccaccgccgaaatcgacgaaaacctcgagcgcccggtggtg
aaggccctgaacgccctggccaagttccgcaacgaactgcctgcattcaatggcgagttc
agctacgaagccgacggcgacacatccatcaccttccgctggatcgctgccgacggcaag
accaaggccgccctcatcttcgagcccggccgcggactcggcacggataacaccactccg
gtcgccagcctcgcctggaccgatgccgccggtgaccacgagactgatgatctgctgagc
aacccgccgattgtcgatatcgactaa

DBGET integrated database retrieval system