KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0144Help
Entry
BLIJ_0144         CDS       T02092                                 

Definition
putative alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:blon00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:blon00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:blon02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
166621..168699
Genome map
AA seq 692 aa AA seqDB search
MGNHKALTSAVAAIASIATLGALAAPAFAVDAANGTYSPNGKSVAELAKHGAAQRIAAIG
NKSAKNVVLFIGDGMGDSEITIARDYLKGANGHFDGLDAVGQPGALDDVQAGTGQYTTFS
LGDGSKDSAVGKDAAGKLVANPNPGKLTPVTDSSASGSAWATGTKTYNNAVDVDIYGNPQ
LNLFELAKAAGKATGNVSTAEIQDATPAVLESHSTERACYGPQGKTDGTSNNASKQCLAN
QLKENGGIGSISEQLLDTRADVTIGGGSKYFRQTVQGGEYKGKTVWEQAKDMGFQTVEND
PAAMNALQYKDGQPVLALMSDGNMPTKFNPSKATAKDPAKDANPTVCTPNDAWLGNRGAS
LKDMTKKALDLLNANPNGQKNGFLLQVEGASIDKQDHAANACGQIGETDDFDQAIAYAIK
NVDLTNTLVIVTADHAHTSQVLNAQPAYALSTVLKSADGNNMVVSYGTAQAASTDAEGGY
NGGDMEHTGTQLRIAASGPGAQRVIGLTDQTDNFYTIAGALGLATSPDEQNALSKDGTVK
VARTQAGKYVANVDGFNGDALLSYELKDKNGAVVSKSDSSTPLSGVRVKPAQTTSIALDK
MSEGAEYTLTVTGRQSGKVATVAIQAPAAGSADKKPGADKNGVIASGKVPNDSAVSGPLG
ATGTAVMAIAIAAVMLVAIAMLIKAARNARNN
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatcacaaggctttgacgagcgccgtagcggcgatcgcctccattgcgacgctc
ggcgcgctcgccgctccggcgtttgctgtcgatgccgcgaacggcacctacagccccaac
ggcaagtcggtcgccgagctcgccaagcacggcgcggcgcagcgcatcgccgccatcggc
aacaagagcgcgaagaacgtcgtgctgttcatcggcgacggcatgggcgattcggaaatc
accatcgcccgcgactatctgaaaggcgccaacggccacttcgatggtctggacgcggtc
ggtcagcccggcgcgcttgacgacgtgcaggcgggcaccggtcagtacacgaccttctcg
ctcggcgacggcagcaaggacagcgccgtcggcaaggatgccgccggcaagctggtcgcc
aaccccaacccgggcaagctcacccccgtcaccgattcctccgcgtccggttccgcatgg
gcgaccggcaccaagacctacaacaacgccgtcgacgtcgacatctacggcaacccgcag
ctgaatctcttcgagctggccaaggccgccggcaaggccaccggcaacgtgtccaccgcg
gaaatccaggacgccaccccggccgtgctggaatcgcactccaccgagcgtgcctgctac
ggcccgcagggcaagaccgacggcacttccaacaacgcctccaaacagtgcctcgccaac
cagctcaaggagaatggcggcatcggctccatctccgagcagctgctcgacacccgcgcc
gatgtgaccatcggcggtggttccaagtacttccgccagaccgtgcagggcggcgaatac
aagggcaagaccgtgtgggagcaggccaaggacatgggcttccagaccgttgagaacgac
ccggccgcgatgaacgccctgcagtacaaggatggccagccggtgctcgccctgatgagc
gacggcaacatgccgaccaagttcaacccgtccaaggccaccgccaaggatccggccaag
gacgccaacccgaccgtgtgcaccccgaatgacgcctggctcggcaaccgtggcgcctcg
ctcaaggacatgaccaagaaggcgctcgatctgctcaacgccaacccgaacggtcagaag
aacggcttcctcctgcaggtcgaaggcgcttcgatcgataagcaggaccacgccgccaac
gcctgcggccagatcggcgagaccgacgacttcgaccaggccatcgcctacgccatcaag
aacgtggacctcacgaacacgctggtgatcgtcaccgccgatcatgcgcacacctcccag
gtcctcaacgcccagccggcctacgcgctgtccaccgtgctcaagtccgccgacggcaac
aacatggtcgtctcctacggcaccgcccaggcagcctccaccgacgccgaaggcggctac
aacggcggcgacatggagcacaccggcacccagctgcgcatcgccgcttccggccccggc
gcccagcgcgtcatcggcctgaccgatcagaccgacaacttctacaccatcgccggcgcc
ctgggcctggccacctcccccgacgagcagaacgcgctctccaaggatggcaccgtgaag
gtcgcccgcacgcaggccggcaagtacgtcgccaatgtcgacgggttcaacggcgacgcg
ctgctcagctacgagctgaaggacaagaacggcgccgtggtgtccaagtccgattccagc
accccgttgtccggcgtgcgcgtcaagcccgcgcagaccacttcgatcgcgctcgacaag
atgtcggaaggcgccgagtacacgctcaccgtcaccggtcgccagtccggcaaggtcgcg
accgtcgccatccaggcgccggccgccggctccgccgacaagaagccgggcgccgacaag
aacggcgtgatcgcttcgggcaaggtgccgaacgattccgcggtctccggcccgctgggc
gccaccggtaccgccgtcatggccatcgccatcgcggctgtgatgctggttgcgatcgcg
atgctcattaaggccgcgcgtaacgccaggaacaactga

DBGET integrated database retrieval system