KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0165Help
Entry
BLIJ_0165         CDS       T02092                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:blon03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190108..190710
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDAFGRLPGIGPKGAQRIAFYMLSAPEDEARDLAEAIEEVKAKIRFCD
ICGNVCESSPCPVCADPRRDRSVICVVEEPKDVMSIERTREYRGLYHVLGGAINPMANVG
PADLRIPSLLKRLEGDEVKEVIMALDPNIEGEATTSYLTQLLRPVGVKVTRLASGLPVGS
DLEYADEITLGRALAGRREA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcttatgacggcgcaatacagcgactgatcgacgctttcgggcggctgccc
ggcatcgggccgaagggcgcgcagcgtatcgccttctacatgctgtccgcgcccgaagat
gaagcgcgcgatctggccgaggccatcgaggaggtcaaggccaagatccgcttctgtgat
atttgcggcaacgtgtgcgaatccagcccctgcccggtatgcgccgacccgagacgcgac
cgttcggtgatctgcgtggtcgaagagcccaaggacgtgatgagcatcgagcgcacgcgc
gaataccgcggcctataccatgtgctcggcggcgcaatcaacccaatggccaacgttggc
cctgccgacctgcgtattcccagtctgctcaaacgcttagaaggcgatgaggtcaaggaa
gtgattatggcgctcgacccgaatattgaaggcgaggccaccaccagctacttgacccag
ctattgcgacccgtaggtgtcaaggtcacccgacttgccagcggcctgccggtgggctcc
gacttggagtacgccgacgaaatcacgctaggcagggcactggccggtcggcgcgaggcc
tag

DBGET integrated database retrieval system