KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0483Help
Entry
BLIJ_0483         CDS       T02092                                 

Definition
putative asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:blon00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(548507..550096)
Genome map
AA seq 529 aa AA seqDB search
MPFTHKNPNRTVIVRGGKPTNYSKLPASISINDEGTCVQVPLLSGDRVFWTVSEDEVLLS
DSASRLASITNADLDLERIVMDLLPSLPDSLRGDKSPWRNIHSIPAATILHLDKSNRPRY
TRAEPSPAKHVPSNEILASLRSRFLTIADEWRNEAPLSADVSGGVDSAAITYVFASEGVR
MPLYHETPDDPMNQDSRWAERISEDVRMPLIKIGRVVDGNRSFEPAAEYPNREIPEEPVY
WSDIEGYLSRISEMEADASRIHVTGFGGDELFASMPSSSWSCLREHPLRLRDIRRQYSAD
YRVPPYQAILDLTDGTDLHEELRSSFLDAEQGHDHRSSPCGWHDAIRIPEFLTAKARNIL
YGAVESQLKHADIRPLSPDRSRHQALYSLSMQARILNQVNRTFSSDDITFRSPYLDHGIA
DYALCAPISARTEGNLHKAVLYRALKGIIPETIFRRPVKGDHSYSLYLAWQRSKDALLDS
IAGGVLDEEGLIDMPAIRRRASMPMPDITFLFEMQRVAAVERWLRHASR
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttacgcataagaacccaaaccgtaccgtgattgtccgcggcgggaagccgacg
aactattcgaagcttcccgcctccatcagcatcaatgacgagggaacatgcgtccaagtt
cctctgctgagtggcgatcgcgtgttctggaccgtctccgaagatgaagtgctcctgtcg
gacagcgcctcccgacttgcaagcatcacgaacgccgatcttgacctggaacgcattgtc
atggatttgctgccttcgctccctgacagccttcgaggggacaaatccccatggaggaac
atacattccatacccgccgcaaccatactgcacctcgacaaatccaataggccgcgatat
acgagagcggaaccttcacccgcaaaacatgttccgagcaacgagatcttggcatcacta
agaagccgtttcctgacgatcgcggatgagtggcgcaatgaggcaccactatccgccgat
gtgtccggaggagtggattccgccgccatcacatacgtcttcgccagcgagggggttcgt
atgcccctgtatcatgaaacacccgacgatccaatgaatcaggattcccgatgggccgag
cgaatctccgaggacgttcggatgccactcatcaaaatcggccgggtcgtggatggaaac
agatcattcgaacccgcagccgaatatcccaacagagagatacctgaagaaccggtctac
tggagcgatatcgaaggctatctcagccgaatctccgaaatggaagcagacgcaagccgt
atccatgtcacgggtttcggaggagacgagctgttcgcatccatgccatcctcatcatgg
agctgcctgcgggaacacccgctacggctacgggacatccgaagacaatacagcgccgat
taccgggtcccaccctatcaggcaattctcgatctcaccgatggcaccgatctgcatgag
gaattacggtcatcgttcctggacgcggaacaaggtcatgaccatcgctcttcgccttgt
ggatggcatgatgccatacgcattcccgaattcctgaccgcgaaagccaggaatatccta
tatggcgccgttgaatcacaattgaaacacgccgacattcggccattgagccccgaccga
agccgtcatcaggcgctctactctctgtcaatgcaggcacgaatactcaatcaggttaat
cggacgttctcctccgacgacataacgttccgctccccctatctggaccacggaatcgcg
gactatgcgctatgcgccccaatcagtgcacgcaccgagggaaatctacacaaagccgtg
ttataccgggcgctcaagggcataatccccgaaacgatattccggcgtcccgtcaaaggc
gatcactcatattcactgtatctggcatggcaacgctcgaaggacgcgctgctcgactca
atcgccggcggagtgctggacgaggagggactgatcgatatgccagccatacggcgtcga
gcttccatgccgatgcctgacatcacattcctgtttgaaatgcaacgagtagcagcagtg
gaaaggtggctgagacatgcaagccgatga

DBGET integrated database retrieval system