KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0554Help
Entry
BLIJ_0554         CDS       T02092                                 

Definition
GTP cyclohydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLIJ_0554
Enzymes [BR:blon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BLIJ_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
621731..622312
Genome map
AA seq 193 aa AA seqDB search
MNENGKSSYDEEGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQASPADVL
EKHFDVDTDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARLVEVYAR
RPQVQERLTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVRGMLRNP
ATRAEAMSLILDK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaacgggaagtcctcatacgacgaggaaggcgtgcgcgaagccgtacgcctg
ttcctgaagtcgattggcgaggatcccgagcgcgagggactggtggaaacgcctgaccgt
atcgcccgcgcgtgccgcgagctgttcgccggtctgcaggcttccccggccgatgtgctg
gagaagcacttcgacgtggataccgacgagctggtgctggtcaaggacatcgaactgtat
tcggtgtgcgagcatcacctgctgccgttccatggcgtggcccatgtgggctatattccc
gccaaggacggggtgatggggctgagcaagctcgcccgactggtcgaggtgtatgctcgc
cggccgcaggtgcaggagcgtttgacccagcagatcgccgacgcgctggtcgagtacgcg
ggcgcacgtggtgtgattgtggtgaccgaatgcgagcacctgtgcatgtcgatgcgcggc
atcaagaaatcctccgcgcgcacggtgacctctgcggtgcgcggcatgctgcgcaatccg
gccacccgagccgaagccatgagcttgattcttgacaagtga

DBGET integrated database retrieval system