KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0556Help
Entry
BLIJ_0556         CDS       T02092                                 

Definition
hypothetical protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:blon00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
623357..624769
Genome map
AA seq 470 aa AA seqDB search
MDTITLTGVHANGTHGVLAFEHERPQTFVVDVTLHLDLAAAGQSDDLNDTIDYGRVAKDI
TAVIEGPHVDLIERLAQRIADEILADAPAVASIDVTVHKPHAPIVVAFADVSVSISRVRA
TDNGRTAEEHAIHNAVVALGGNVGEVESTLRAAVREIDALPGTQVTGISPLYRTAAWGMA
DGTPDFLNAVVELETTMGSHELLAALQNIEANHGRIRENHWDSRPLDLDIIDFDGITSAD
PDLALPHPRAWQRAFVLAPWLALNPNAKLAGAHEGPVADLLATAPDRNAVQLESEDWMLG
GHAVKQESASESAPVSRKAIISLDSTSQDAERLFRETIVSIDSVPGNQVQGISPLYHVSH
FDGPDAMSAVIQIETKLPPADLIAVLGSIESVHDLAVDLDLVDMEGVTSDEPNCSIPWPS
ARNHASVLAPWLDMDPNATLGGDPVAFLLAMAPDAGQVGLLSDNWILSNS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatcacacttaccggcgtacatgccaacggcacccacggtgtgctcgccttc
gaacacgaacggccacaaaccttcgtcgtggatgtcaccctgcaccttgatctggccgca
gccggtcaatccgacgatctcaacgacaccatcgattacggccgtgtggccaaggacatc
acggctgtcatcgaaggccctcatgtggacctgatcgagcgtctggcccaacgtatcgcg
gacgagattcttgccgatgcgccggccgtcgcctccatcgacgtcaccgtgcacaagcct
cacgcacccatcgtcgtggcttttgcagatgtatcggtctccatctcgcgcgtgcgtgcc
accgataatggacgtactgctgaagagcatgccatccataacgcggtggtggccttgggc
ggcaatgtgggcgaggtggaatccaccttgcgagccgccgttcgggagattgacgcgttg
cctggcacacaggtgactggtatctcaccgctttaccgcacggccgcgtggggcatggcc
gacggtacgccggatttcctgaacgccgtggtggagcttgaaaccacaatgggcagccac
gaattgcttgccgcgttgcaaaacatcgaagcgaaccatggacgaattcgtgagaatcat
tgggattccaggccgttggacttggacattatcgactttgatggcatcaccagcgcggat
ccggatctggcattgccccatccgcgtgcttggcagcgtgcgtttgtgctggctccttgg
ttggcattgaatccgaacgccaaactcgccggagcccatgaggggcctgtagccgatttg
ctggccaccgcgccggaccgtaacgccgtgcagctcgagagcgaagactggatgctcggc
gggcatgcagtcaagcaagaatccgcgtcggagtcggcacccgtctcacgcaaggcgatt
atttcgctggattccacctcgcaggatgccgaacggctgttccgtgaaaccatcgtttcc
atcgacagtgttcctggcaatcaggtacagggcatttcgccgctctaccatgtcagccat
ttcgacggcccggacgcgatgagcgcggtcatccaaatcgaaaccaagttgccgcccgcc
gacctgattgccgtattgggcagcatcgaaagcgttcatgatctggcagtcgaccttgac
cttgttgacatggagggcgtgacttccgacgagcccaactgcagcattccttggccgtcg
gcccgtaaccatgcgtcggtattggcaccttggctggatatggacccgaatgctactctg
ggcggcgacccggtggccttccttttggccatggcaccggatgccggacaggtcggattg
ctatcggacaactggatactgtcgaacagttga

DBGET integrated database retrieval system