KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0569Help
Entry
BLIJ_0569         CDS       T02092                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLIJ_0569
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIJ_0569
   00052 Galactose metabolism
    BLIJ_0569
   00500 Starch and sucrose metabolism
    BLIJ_0569
   00520 Amino sugar and nucleotide sugar metabolism
    BLIJ_0569
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BLIJ_0569
   00524 Butirosin and neomycin biosynthesis
    BLIJ_0569
Enzymes [BR:blon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BLIJ_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
641812..642762
Genome map
AA seq 316 aa AA seqDB search
MTTLAIDIGGTKIAAAVCDANDSIIQRWRVPTPMDADAINTHIAEIYREAVAAGHTDIEA
IGISAAGNVSADRKTLTFSANIPAWINYNLSEHVGALIDHAVPIVVENDANCAGWGEFVH
GAGQGSSNMVALTVGTGLGGAIVINGQLYRGSFGMAAELGHLPMVPDGDHCGCGLRGCAE
RYTSGTSLENFAKSAVRRRPQDAKRLLELCGGDITKLEGPMVSQAAQEGDVLGLYAFGKI
GEWLGRTMAAVSAVLDPDLFVIGGGVVAVGDILLEPARYNYQRFLEGSAYRGHAKIVAAV
AGQDAGLIGAANLALR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcgccattgatatcggcggaaccaagatcgccgctgccgtctgcgatgca
aacgacagcatcatccagcgttggcgcgtccccacgccgatggacgccgacgccatcaac
acgcatatcgccgagatctaccgcgaagccgtcgccgctggccacaccgatatcgaggcc
atcggcatctccgcggccggtaatgtgagcgcggatcgcaagacgctcaccttctccgcc
aacattccggcctggatcaattacaatctgtccgagcatgtcggcgcgttgatcgaccat
gccgttccgatcgtcgtcgagaacgatgccaactgcgccggctggggcgaattcgtgcac
ggtgccggccaaggcagctccaacatggtcgcgctgaccgtgggcaccggcctcggtggc
gccatcgtgatcaatggccagctctaccgaggctccttcggcatggccgcagagctcggc
cacctgccgatggtcccggacggagaccattgcggctgcggcctgcgcggctgcgccgag
cgctatacttcgggaacctcgctggagaacttcgccaagtccgccgtgcgtcgtcgtcct
caggacgccaaacgtcttctggagctgtgcggtggcgacatcaccaagctggagggaccg
atggtgtcccaagcggctcaggagggtgacgtgcttggcctgtatgcgttcggcaagatc
ggcgaatggcttggccgcaccatggccgccgtttccgccgtgcttgatccggacctgttc
gtcatcggcggtggtgtggtagccgttggagacattctgctggagccggcccgctacaac
taccagcgtttcctggaaggcagcgcctaccgtggccacgccaagatcgtcgccgcagtc
gcgggccaggacgccggcctcatcggtgccgccaatctggctcttcgctga

DBGET integrated database retrieval system