KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0645Help
Entry
BLIJ_0645         CDS       T02092                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BLIJ_0645
Enzymes [BR:blon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BLIJ_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
736376..737626
Genome map
AA seq 416 aa AA seqDB search
MTKGVRNALAITELFGHPEVEVYKGLPHSSTTDSFTVGEISAFIHGVNGIGDVEIPDSSR
APETESASSSAKRSASDRWLYSSTTTKGNAMTASDILAALDRIQGTVCVVGSMNADYTVV
TERLPGPGETVTGGPLQVLPGGKSGNQAAAAARIGATVHMFGAVGSDANAEFLLGALREA
GVDTQHVRHVPGASGTTVITVDANGENTIVYSPGSNAQVSVDYIEAMRGELTSANVLGLC
LESPIETVTAAARIGHEAGVPVLLNNSPFTPVLPDELVQLADILLVNEHEMAQMFGIAEP
EDGDWSGFDWLAAADRMRELGFDRAIVTLGGDGSMVLDASCAVASVTRIAPVRVEAVDTT
GCGDSFMGAVLAGLASGFELREAAQLASFVSAYAATGLGAQASYGSAAQIRELFVP
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaaaggtgtgcgtaacgcgctcgccatcaccgaactgttcggtcatccggaagtc
gaggtttacaagggtctaccacattccagcaccaccgattccttcaccgtgggcgagatt
tccgccttcatccacggcgtcaacggcatcggtgatgttgaaattccggattctagccgt
gcaccggaaaccgaatccgcctcgtcatccgcaaaaagatcggcgagtgatcgttggctc
tattcgtcaacgacaacgaaaggaaatgctatgacagcatctgacattcttgcggcactt
gatcgaatccaaggcacggtttgcgtcgtcggttcgatgaatgccgattacacagtggtc
accgagcgtctgcccggaccgggggagactgtcaccggcggcccgctgcaagtgttaccc
ggcggcaaatccggcaaccaggctgctgctgcggcacgtattggcgccactgttcacatg
tttggagcggtgggttccgatgccaatgccgagttcctgcttggtgcattgcgagaagcc
ggcgtggatacccagcacgtgcgtcatgtaccgggggccagcggtaccacagtcatcacc
gtggacgcgaacggagagaacacgattgtctactctccgggctccaatgcgcaggtcagt
gttgattatatcgaggcgatgcgcggtgaattgacttcggcgaatgtgcttggcctgtgc
ttggaaagcccgatcgagaccgttaccgcggctgcgcgtatcgggcatgaagccggtgtg
ccggtactgctcaacaattcaccgtttacgccggtgctgccggacgagctggtgcagctt
gccgatatcctgctcgtcaacgagcatgagatggcgcagatgttcggtatcgccgaaccc
gaagacggcgactggtccggattcgactggctggctgcggccgatcgtatgcgggagctc
gggttcgaccgggcgattgtgacgctcggcggtgatggctcgatggtgctggatgcatca
tgtgctgttgcttcggtgacccgcatcgcaccggttcgggtcgaagccgtggacaccacc
ggttgcggcgactcgttcatgggtgccgtgctggcagggctggcctcaggctttgagctg
cgtgaagcggctcagctggcttcgttcgtttctgcatatgcggctaccggtctgggtgcc
caagcgtcttacggttccgccgcccagattcgtgagctatttgtgccctga

DBGET integrated database retrieval system