KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0794Help
Entry
BLIJ_0794         CDS       T02092                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BLIJ_0794
Enzymes [BR:blon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BLIJ_0794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
902570..903760
Genome map
AA seq 396 aa AA seqDB search
MSIASNSTVIILGSTGSIGTQGLDVIARHPERFTVTGLAAGGAHIELLAQQAAQFHVSEV
AVFDETKIPALQAALAQAGAQGVRVTGGPDSVIAMAGSGANVVLNGITGSIGLEPSIAAL
KAGSQLALANKESVVAGGHLLFSAQVRENQINPVDSEHSAIWQSLRSGTHAEVAKLVVTA
SGGPFRGWKRADMENITPEQALHHPTWNMGPVVTINSSTLMNKGLEVIEASRLFDVPPER
IDVTVHPQSIVHSMVEFVDGATICQASPPDMRLPIALGLSAPDRMANVAAACDWTKAATW
TFEPLDDEAFPAVQLARHCLAASEKHTAVLNAANEQAVHAFLEHRLPYLGIVDTVKAVLD
QMDAELRGNPLFTDVEEMNQLELEARRRADDLINKQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatagcctccaactccaccgtcatcattctcggatccactggatccatcggcacc
caaggacttgacgtcatcgcgcgtcaccctgaacgatttaccgtcaccggtctggcggcg
ggcggagcacatatcgagctgctggcgcaacaggccgcacagttccatgtgtccgaagtc
gcggtgtttgatgagaccaagattccagcactgcaagcagctctcgcacaggccggcgca
caaggtgtccgcgtgaccggcggtccggattcggtcatcgccatggccggatccggtgcg
aatgtcgtattgaacggcatcaccggctccatcggcctcgaaccgtcgatcgcggcgctc
aaggccggttcccagctggcattggccaacaaggagtccgtagtcgcgggcggtcatctg
ctgttcagcgcccaagtacgcgagaaccagatcaacccggtcgattccgaacattccgcc
atctggcaatccctgcgctccggaacccacgccgaagtcgccaagcttgtggtcaccgcc
tccggcggaccgttccgcggttggaaacgtgccgacatggagaacatcactcccgagcag
gcgctgcatcatccgacgtggaacatggggccggttgtcaccatcaactcctccacgctg
atgaacaaggggctcgaagtcatcgaggcgtcccgcttgttcgacgttccgcctgaacgc
atcgacgtgaccgtgcacccgcagtccatcgtccattccatggtcgaatttgtggacggc
gccacgatttgccaggcttcgccgccggacatgcgtctgcccatcgcgctgggcctgtcc
gcgccggaccgcatggccaatgtggccgccgcgtgcgactggacgaaagccgcaacttgg
acctttgaaccgttggacgatgaggcgttccccgccgtgcaactggcccgtcactgcctg
gccgcctccgagaagcatacggcggtgctgaatgcggccaatgaacaggccgtgcatgcc
ttcctcgagcatcgtctgccatacctcggcatcgtggacacggtcaaagccgtgctggac
cagatggacgccgagcttcgtggtaacccgctgttcacggacgtggaggaaatgaaccaa
cttgagcttgaagcccgccgacgcgccgacgacctgataaacaagcaatga

DBGET integrated database retrieval system