KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_0839Help
Entry
BLIJ_0839         CDS       T02092                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLIJ_0839
  Amino acid metabolism
   00340 Histidine metabolism
    BLIJ_0839
Enzymes [BR:blon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BLIJ_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
969363..970745
Genome map
AA seq 460 aa AA seqDB search
MRIIDLRGQHLSRAELLAAMPRAAMGTSEATDLVRPILDDVKERGAAALRDFEEKFDHVR
PKNLRVPVEAIKDALTTLDPEVRAAIEESVRRARAVAANQVPKDFYTDLAEGARVAERWI
PIQRVGLYVPGGKAVYPSSVIMNAVPAQAAGVESLAIATPPARDNEEGLPNKTILATCAI
LGVDEVYAVGGAQAIAMFAYGAKGSEPQDGDILCDPVDKITGPGNIFVATAKSLVSAFVG
IDAVAGPTEIGIIADATANPSLLAADLIGQAEHDELAGSVLFTDSTEIADKVQENLKYRV
PRTEHAERVHTSLSGTQSAIVLTDGLDQSIDAANAYAAEHLEIQTKDADAVVKRIKNAGA
IFRGPYSPVPLGDYMSGSNHVLPTGGTARFAAGLGVHTFMKPVEVIEYDEEGLKALAARI
NAFAVSEDLPAHGECVLSRFVKDPYDKATLREQEKGAGLR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcattgacctgcgtggtcagcacctgtcccgtgccgaactgctcgccgcgatg
ccgcgcgccgcaatgggcacttccgaagccaccgatctggtgcgtccgattctggacgat
gtcaaggaacgcggtgccgcggccctgcgcgacttcgaggagaagttcgatcacgtgcgt
cccaagaacctgcgcgtgccggtcgaggcgatcaaggacgccctgaccacgctcgacccc
gaagtgcgcgctgccatcgaggaatcggtacgccgcgcccgcgccgtggccgccaaccag
gtgccgaaggacttctacaccgacctcgccgaaggtgcccgcgtggccgaacgctggatt
ccgattcagcgcgtcggcctgtatgtgcccggcggcaaggccgtctacccgagctccgtc
atcatgaacgctgtgccggcccaggccgccggcgtcgaatcgctggccatcgccaccccg
cccgcccgcgacaatgaggaaggcctgccgaacaagaccatcctcgccacctgcgccatc
ctcggtgttgacgaggtatacgcggtcggcggcgctcaggccatcgccatgttcgcatac
ggcgccaagggcagcgagccacaggacggcgacatcctgtgcgatccggttgacaagatc
accggcccgggcaacatcttcgtggccaccgccaagtcgctggtctccgcattcgtgggc
atcgacgcggtcgccggccccaccgaaatcggcatcatcgccgatgcaaccgccaacccg
agtctgctggccgccgacctcatcggccaggccgagcatgatgagctcgccggttccgtg
ctgttcaccgactccaccgagattgccgacaaggtgcaggagaacctcaagtaccgcgtg
ccgcgtaccgagcacgccgagcgtgtccacacgtcactgtccggcacccagtctgccatc
gtgctgaccgacggtctcgaccagtccatcgacgcggccaacgcctacgccgccgaacac
cttgagattcagaccaaggatgccgatgctgtcgtcaagcgcatcaagaacgccggtgcc
atcttccgcggcccgtactccccggtgccgctgggcgactacatgtccggctccaaccac
gtgctgcccaccggcggcaccgcccgcttcgccgccggcctcggcgtgcacaccttcatg
aagccggtcgaagtcatcgaatacgacgaggaaggcctgaaggcactcgccgcccgcatc
aacgcctttgcggtgtccgaggatctgcccgcccacggcgagtgcgtgctctcccgcttc
gtcaaggatccgtatgacaaggccaccctgcgcgagcaggagaagggagccggtctgcga
tga

DBGET integrated database retrieval system