KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1112Help
Entry
BLIJ_1112         CDS       T02092                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLIJ_1112
   01230 Biosynthesis of amino acids
    BLIJ_1112
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIJ_1112
   00051 Fructose and mannose metabolism
    BLIJ_1112
   00562 Inositol phosphate metabolism
    BLIJ_1112
Enzymes [BR:blon01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BLIJ_1112
Exosome [BR:blon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BLIJ_1112
  Exosomal proteins of bladder cancer cells
   BLIJ_1112
  Exosomal proteins of melanoma cells
   BLIJ_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1274571..1275374
Genome map
AA seq 267 aa AA seqDB search
MASKRIPLVAGNWKMNFDHLEATYFVQKLVWLLRDAHFDFKRCEVALFPSFTSLRSVQVL
VEADKLHVAYGAQSVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVFAAGMQPILCVGESFEERRQGIELDFAVGQVRDVTRDLNEEQAAELIVAYEPVWA
IGTGMVATPQSAQDAANAIRNDLKTTFGTKVSDSVHILYGGSVTSKNAAELISQPDVDGF
LIGGAALDVEELAKIARLALKSMKSRN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaacgcattccgttggtggccggcaactggaagatgaatttcgaccatctt
gaagccacttacttcgtgcagaagctggtatggctgttgcgtgacgctcacttcgacttc
aaacgctgcgaagtcgcgcttttcccctcgttcacgtcattgcgcagcgtacaggtgctg
gtcgaagccgacaagctccatgtcgcctacggcgcacaatccgtttccgtgaccacccaa
ggtgccttcaccggcgatgtgtccgcggacatgatcgcccatctcggctgctcatacgtc
atcgtcggccactccgaacgccgcaaataccatcctgaagatgacgccaatatcgtcgat
caggtacgtgccgtgttcgccgccggcatgcagccgattttgtgcgtcggcgaaagcttc
gaggaacgacgtcaaggcattgaactcgatttcgccgtgggccaggtacgagacgtcacc
cgcgatctcaacgaagaacaagccgccgaactcatcgtggcctacgaacctgtctgggcc
attggcaccggcatggtggccactccgcaatccgcccaggatgccgcaaacgccatccgc
aacgatttgaagaccacctttggcacgaaggtatccgatagcgtacatatcctgtacggc
ggatcggtcacctcgaaaaatgcggcggaactcatttcccagcccgacgttgacggcttc
ctgatcggaggggcggccttggacgttgaggaactcgccaaaatcgctcgattggcactt
aaatccatgaaatcacggaactaa

DBGET integrated database retrieval system