KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1112Help
Entry
BLIJ_1112         CDS       T02092                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:blon01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:blon01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:blon00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:blon00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:blon00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1274571..1275374
Genome map
AA seq 267 aa AA seqDB search
MASKRIPLVAGNWKMNFDHLEATYFVQKLVWLLRDAHFDFKRCEVALFPSFTSLRSVQVL
VEADKLHVAYGAQSVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVFAAGMQPILCVGESFEERRQGIELDFAVGQVRDVTRDLNEEQAAELIVAYEPVWA
IGTGMVATPQSAQDAANAIRNDLKTTFGTKVSDSVHILYGGSVTSKNAAELISQPDVDGF
LIGGAALDVEELAKIARLALKSMKSRN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaacgcattccgttggtggccggcaactggaagatgaatttcgaccatctt
gaagccacttacttcgtgcagaagctggtatggctgttgcgtgacgctcacttcgacttc
aaacgctgcgaagtcgcgcttttcccctcgttcacgtcattgcgcagcgtacaggtgctg
gtcgaagccgacaagctccatgtcgcctacggcgcacaatccgtttccgtgaccacccaa
ggtgccttcaccggcgatgtgtccgcggacatgatcgcccatctcggctgctcatacgtc
atcgtcggccactccgaacgccgcaaataccatcctgaagatgacgccaatatcgtcgat
caggtacgtgccgtgttcgccgccggcatgcagccgattttgtgcgtcggcgaaagcttc
gaggaacgacgtcaaggcattgaactcgatttcgccgtgggccaggtacgagacgtcacc
cgcgatctcaacgaagaacaagccgccgaactcatcgtggcctacgaacctgtctgggcc
attggcaccggcatggtggccactccgcaatccgcccaggatgccgcaaacgccatccgc
aacgatttgaagaccacctttggcacgaaggtatccgatagcgtacatatcctgtacggc
ggatcggtcacctcgaaaaatgcggcggaactcatttcccagcccgacgttgacggcttc
ctgatcggaggggcggccttggacgttgaggaactcgccaaaatcgctcgattggcactt
aaatccatgaaatcacggaactaa

DBGET integrated database retrieval system