KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1112Help
Entry
BLIJ_1112         CDS       T02092                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
blon00010  Glycolysis / Gluconeogenesis
blon00051  Fructose and mannose metabolism
blon00562  Inositol phosphate metabolism
blon01100  Metabolic pathways
blon01110  Biosynthesis of secondary metabolites
blon01120  Microbial metabolism in diverse environments
blon01130  Biosynthesis of antibiotics
blon01200  Carbon metabolism
blon01230  Biosynthesis of amino acids
Module
blon_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIJ_1112
   00051 Fructose and mannose metabolism
    BLIJ_1112
   00562 Inositol phosphate metabolism
    BLIJ_1112
Enzymes [BR:blon01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BLIJ_1112
Exosome [BR:blon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BLIJ_1112
  Exosomal proteins of bladder cancer cells
   BLIJ_1112
  Exosomal proteins of melanoma cells
   BLIJ_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AAA_26
Motif
Other DBs
NCBI-ProteinID: BAJ68700
Position
1274571..1275374
Genome map
AA seq 267 aa AA seqDB search
MASKRIPLVAGNWKMNFDHLEATYFVQKLVWLLRDAHFDFKRCEVALFPSFTSLRSVQVL
VEADKLHVAYGAQSVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVFAAGMQPILCVGESFEERRQGIELDFAVGQVRDVTRDLNEEQAAELIVAYEPVWA
IGTGMVATPQSAQDAANAIRNDLKTTFGTKVSDSVHILYGGSVTSKNAAELISQPDVDGF
LIGGAALDVEELAKIARLALKSMKSRN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaacgcattccgttggtggccggcaactggaagatgaatttcgaccatctt
gaagccacttacttcgtgcagaagctggtatggctgttgcgtgacgctcacttcgacttc
aaacgctgcgaagtcgcgcttttcccctcgttcacgtcattgcgcagcgtacaggtgctg
gtcgaagccgacaagctccatgtcgcctacggcgcacaatccgtttccgtgaccacccaa
ggtgccttcaccggcgatgtgtccgcggacatgatcgcccatctcggctgctcatacgtc
atcgtcggccactccgaacgccgcaaataccatcctgaagatgacgccaatatcgtcgat
caggtacgtgccgtgttcgccgccggcatgcagccgattttgtgcgtcggcgaaagcttc
gaggaacgacgtcaaggcattgaactcgatttcgccgtgggccaggtacgagacgtcacc
cgcgatctcaacgaagaacaagccgccgaactcatcgtggcctacgaacctgtctgggcc
attggcaccggcatggtggccactccgcaatccgcccaggatgccgcaaacgccatccgc
aacgatttgaagaccacctttggcacgaaggtatccgatagcgtacatatcctgtacggc
ggatcggtcacctcgaaaaatgcggcggaactcatttcccagcccgacgttgacggcttc
ctgatcggaggggcggccttggacgttgaggaactcgccaaaatcgctcgattggcactt
aaatccatgaaatcacggaactaa

DBGET integrated database retrieval system