KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1184Help
Entry
BLIJ_1184         CDS       T02092                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:blon03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1338801..1339427
Genome map
AA seq 208 aa AA seqDB search
MIGMLTGRVESVETDTALIDVGGVGYETRMPATDLGRLHAGQDACVFTYLNLSQDSVTLY
GFLDRDSKRVFLQLIKVSGIGPKVAQSLLGTMTPSQLARAIADNDAAALAKAPGLGRKGA
QKIILELKGSVDLNQSDDASAGNAPYQPTVDAGVEQVVEGLVSLGWRQQDAQRAVNEACA
ENDVPMPLASDDAPRVLRLALARMDRGR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattggcatgctgaccgggcgggtggaatcggttgaaaccgacaccgcattgatcgac
gtcgggggagtgggctatgagacgcgcatgcccgccaccgacttgggccgcctgcacgcc
ggccaggacgcctgcgtcttcacgtatctgaacctctcgcaggattctgtcacactgtac
gggttcctcgaccgggactccaagagagtgttcctgcagctcatcaaggtctccggcata
ggaccgaaggtggcgcagtcgctgctgggcacgatgaccccaagccagctggcccgcgcc
atcgccgacaatgacgccgccgcactggccaaggcgccgggattgggcaggaagggcgcg
cagaagatcatcctggagctcaagggatccgtcgatctgaaccagtccgatgacgcgtcg
gccggcaacgctccataccagccgaccgtcgacgccggcgtggagcaggtcgtggagggg
ctggtctctcttggctggcgtcagcaggacgctcagcgggccgtcaacgaagcctgcgca
gagaacgatgttcccatgccgctggcctccgacgatgcgccgcgtgtgctgcggctcgcc
ttggcccgtatggatagggggcgctga

DBGET integrated database retrieval system