KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1196Help
Entry
BLIJ_1196         CDS       T02092                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLIJ_1196
   00052 Galactose metabolism
    BLIJ_1196
   00500 Starch and sucrose metabolism
    BLIJ_1196
   00520 Amino sugar and nucleotide sugar metabolism
    BLIJ_1196
Enzymes [BR:blon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BLIJ_1196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1352956..1354485
Genome map
AA seq 509 aa AA seqDB search
MTEINDKAQLDIAAADDTDAVTSDTTEETVNTPEVDETFELSAAKMREHGMSETAINQFR
HLYDVWRHEEASSWIREDDIEPLGHVPSFHDVYETINHDKAVDAFAKTAFLKLNGGLGTS
MGLDKAKSLLPVRRHKAKQMRFIDIILGQVLTARTRLNVELPLTFMNSFRTSADTMKALK
QHRKFSQHDVPMEIIQHQEPKLVAATGEPVSYPVNPELEWCPPGHGDLFSTIWESGLLDV
LEEHGFKYLFISNSDNLGARPSRTLAQHFENTGAPFMAEVAIRTKADRKGGHIVRDKATG
RLILREMSQVHPDDKEAAQDITKHPYFNTNSIWIRIDALKDKLAECDGVLPLPVIRNKKT
VNPTDPNSEQVIQLETAMGAAIGLFNGSICVQVDRMRFLPVKTTNDLFIMRSDRFHLTDT
YEMEDGNYIFPNVELDPRYYKNIHDFDERFPYAVPSLAAANSVSIQGDWTFGRDVMMFAD
AKLEDKGEPSYVPNGEYVGPQGIEPDDWV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaaataaacgataaggcccaactggatatcgccgccgctgacgacaccgacgcc
gtcacctcggacaccaccgaagaaaccgtaaacacccctgaagtggatgagactttcgag
ctttcggccgccaagatgcgcgagcatggcatgagcgaaaccgccatcaaccagttccgc
catttgtatgacgtatggcgccatgaagaagcctccagctggattcgtgaggacgacatc
gagccgcttggccacgtgcccagcttccacgacgtctatgagaccatcaaccacgacaag
gccgtggacgccttcgccaagaccgcattcctcaagctcaatggcggtctgggcacctcc
atgggattggacaaggccaagtcgctgttgccggtgcgtaggcacaaggccaagcagatg
cgcttcatcgacatcatcctcggccaggtgctcaccgcccggacccgtctgaacgtggaa
ctgccgctgaccttcatgaattccttccgcacttcggcggacacgatgaaggcgctcaag
cagcatcgaaagttcagccagcatgacgtgccgatggaaatcatccagcatcaggaaccc
aagctcgtggccgccaccggcgaacctgtgagctaccctgtgaacccggagctggaatgg
tgcccgcccggccacggcgacctgttctccaccatctgggagtctggtctgcttgacgta
ttggaggagcacggcttcaagtatctgttcatctccaattccgacaatctcggtgcgcgc
ccctcgcgtacgttggcccagcacttcgaaaacacaggtgccccgtttatggctgaagtg
gccatccgcaccaaggccgatcgcaagggcggccatattgtgcgcgacaaggccactggt
cgcctaatactgcgtgaaatgagccaggtccatccggacgataaggaagcggcccaagac
atcaccaagcatccttacttcaacaccaactcgatctggattcgtatcgacgctttgaaa
gacaagctcgctgaatgcgatggtgtgttgccgttgccggtgattcgtaacaaaaagaca
gtgaatcccacggacccgaactccgaacaggtgattcagctggaaaccgccatgggtgcc
gcaatcggtctgttcaacggttccatctgcgtccaagtggatcgtatgcgcttccttccg
gtgaaaaccaccaatgatttgttcattatgcgttccgatcgcttccatctgacggacacg
tatgagatggaagacggcaactacatcttcccgaacgtcgaacttgatccgcgatactac
aagaacatccacgatttcgacgaacggttcccctacgccgtgccatctttggccgcagcc
aactcggtttccattcagggcgactggacattcggacgtgacgtcatgatgttcgccgac
gccaaactggaagataagggcgagccaagctatgtgccgaacggcgaatacgttggcccg
caaggcatcgaaccggacgattgggtgtga

DBGET integrated database retrieval system