KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1414Help
Entry
BLIJ_1414         CDS       T02092                                 

Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
blon00260  Glycine, serine and threonine metabolism
blon00400  Phenylalanine, tyrosine and tryptophan biosynthesis
blon01100  Metabolic pathways
blon01110  Biosynthesis of secondary metabolites
blon01130  Biosynthesis of antibiotics
blon01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLIJ_1414
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLIJ_1414
Enzymes [BR:blon01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLIJ_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB
Motif
Other DBs
NCBI-ProteinID: BAJ68997
Position
complement(1537435..1538304)
Genome map
AA seq 289 aa AA seqDB search
MTNEANTPSGQPLGISHKPSKSGAMFTKFKAENKPAFIGYLPYGFPNPDVSLDAFKTMVE
HGVDAVEIGLPYSDPVMDGPVIQAAASIALNNGETIKRVFEAVETVANAGGVPLIMSYWN
LVYHYGVERFARDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSSTERLE
TVARNARGFVYAAARMGVTGERATIDASPEELVVRTRRAGAENVCVGIGVSTAEQGARVG
AYADGVIVGSALVHTMLADDDKTARDPKEGLKLLAAKSEELAEGIHNAR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgaagcgaatacgccgtccggccagccgctgggcatcagccacaagcccagc
aagtcgggcgctatgttcaccaagttcaaggccgagaacaagcccgccttcatcggctac
ctgccctatggcttccccaacccagacgtctcgcttgacgccttcaaaacgatggtcgag
cacggcgtcgatgccgtggagatcggcctgccgtactccgacccggtcatggacggcccg
gtcatccaggctgccgcctccatcgccctgaacaacggcgagaccatcaagcgcgtgttc
gaggccgtcgaaaccgtggccaacgccggcggcgtgccgctcatcatgagctactggaac
ctcgtataccactacggcgtcgagcgtttcgcccgtgacttcgagaacgccggcggcgcc
ggcctcatcaccccggaccttatcccggacgaggcgggggagtggattgaagcctccgac
cgtcacggactcgaccgcatcttcctggtctccccggactcgtccaccgagcgcctcgaa
accgtggcccgcaacgcgcgtggcttcgtgtacgcggccgcccgcatgggcgtcaccggg
gaacgcgccaccatcgacgcctcacccgaagagcttgtggtgcgcacccgtcgcgcgggc
gctgagaacgtgtgcgtgggcatcggcgtatccaccgcggaacagggcgcccgggtcggc
gcctacgcagatggcgtcatcgtcggttccgcgctcgtgcacaccatgctcgcggacgac
gacaagaccgcacgcgacccgaaggaaggcttgaagctgctcgccgccaagagcgaggaa
ctggccgaaggcatccacaacgcccggtaa

DBGET integrated database retrieval system