KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1497Help
Entry
BLIJ_1497         CDS       T02092                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BLIJ_1497
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BLIJ_1497
Enzymes [BR:blon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BLIJ_1497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1609234..1610196)
Genome map
AA seq 320 aa AA seqDB search
MVGKSVVTLDGLSTNQILDLLHKAEYIDSHRKEVAHTCDGRVLATLFYEPSTRTRLSFET
AMLRLGGKVIGFAGAQLASVTKGESIADTLKTVSNYVDVVAIRHPKEGAALVASRAASVP
VINAGDGGHMHPTQTLADLATLQSRFGRITDLTVGLCGDLTFGRTVHSLIETLCRFGNVR
FVLISPDELKTPQYVIDRINATDNCSYVEVRDLASVIGDLDVLYMTRVQKERFFNEDDYL
RLRDTYILDEEKLQLAKPSMAVLHPLPRVNEIAVDVDDDPRAAYFEQVKNGMLVRMALES
TVVGDELPGYEPLNSKEVHA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcaaaagcgtcgtaacgctggacggcctgtctacaaaccagattctcgacctg
ctgcataaggccgaatacatcgattcccaccgcaaagaggttgcccatacctgcgatggg
cgagtgctggccacgctgttctacgagccctccacccgtacgcgcctgagctttgagacc
gcaatgctgcgtctcggcggcaaggtcatcggattcgccggcgcgcagctggcctccgtg
accaagggcgaatccatcgccgacacgttgaagaccgtgtccaactacgtggacgtggtc
gccatccgtcacccgaaggagggtgccgcgctggtggcctcccgcgccgcatccgtgccg
gtgatcaacgccggcgacggcggccacatgcaccccacgcagacgctggccgacctggcc
acgttgcagtcgcgcttcggccgcatcaccgacctgaccgtgggactgtgcggcgatttg
accttcggccgcactgtgcactccctgatcgagaccctgtgccgcttcggcaacgtgcgc
ttcgtgctcatcagcccggacgagctcaagaccccgcagtacgtgatcgaccgcatcaac
gccacagacaactgctcctacgtggaagtgcgcgacctggcctccgtgatcggcgacctc
gacgtgctgtacatgacccgcgtacagaaggaacgcttcttcaacgaagacgactacttg
cgcctgcgcgacacctacattctcgacgaagagaagctgcagctcgccaagccgtccatg
gccgtgcttcacccgctgccgcgcgtcaacgaaatcgccgtggacgtggacgacgacccg
cgtgccgcctacttcgaacaggtcaagaacggcatgctcgtgcgcatggccctcgaaagc
accgtggtgggcgacgaactgcccggatacgaaccgctcaactccaaggaggttcatgcc
tga

DBGET integrated database retrieval system