KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1678Help
Entry
BLIJ_1678         CDS       T02092                                 

Definition
putative amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BLIJ_1678
Enzymes [BR:blon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BLIJ_1678
    3.5.1.-  
     BLIJ_1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1773717..1774409
Genome map
AA seq 230 aa AA seqDB search
MAMMRAIARRVRDNIQNESKAIGGMTMTKALIVVDVQPTFCEGGELGVEGGNAVAERIAD
YVNAHRSEYAYIATTQDWHIEPGAHWSAEPDFVDTWPKHGAAGTPNAELHTAIKALNIQH
HFKKGQYSAAYSGFEGIEDNTDRIQTREEVTAEQSAGKTLANALKAAGVSRVDVVGIAES
HCVKDTALDAGKLGFEVTVFEGLTVPVSEELGVAARKQMTAASITLAESR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggctatgatgagagcaatcgcacgtcgagttcgagacaatattcaaaacgaatccaag
gcaatagggggaatgacgatgaccaaggcactgattgtggtggatgtgcagccgacgttc
tgtgaaggcggcgaactgggagtcgaaggcggcaacgcggtcgccgagcggatcgccgat
tatgtgaacgcgcatcgcagcgagtacgcgtatatcgcaaccacgcaggactggcatatc
gagccgggcgcgcactggtcggcggaaccggatttcgtggacacgtggccgaagcatggt
gcggccggcacgccgaacgccgaattgcatacggcgatcaaggcgctgaatatccagcat
catttcaagaagggccagtattcggcggcatattccggttttgagggcatcgaggacaat
accgaccgtatccagacccgcgaggaggtcacggccgagcaatccgccggcaagacgctg
gccaatgcgctgaaggccgccggcgtgagtcgcgtggatgtggtgggcatcgccgaatcg
cattgcgtcaaggacaccgcgctcgatgccgggaagcttggtttcgaggtcaccgtgttc
gagggcctgaccgtaccggtcagcgaggagctcggtgtcgctgcccgcaaacagatgacg
gcggccagcatcacattggccgagtcccgctga

DBGET integrated database retrieval system