KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1678Help
Entry
BLIJ_1678         CDS       T02092                                 

Definition
putative amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:blon00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1773717..1774409
Genome map
AA seq 230 aa AA seqDB search
MAMMRAIARRVRDNIQNESKAIGGMTMTKALIVVDVQPTFCEGGELGVEGGNAVAERIAD
YVNAHRSEYAYIATTQDWHIEPGAHWSAEPDFVDTWPKHGAAGTPNAELHTAIKALNIQH
HFKKGQYSAAYSGFEGIEDNTDRIQTREEVTAEQSAGKTLANALKAAGVSRVDVVGIAES
HCVKDTALDAGKLGFEVTVFEGLTVPVSEELGVAARKQMTAASITLAESR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggctatgatgagagcaatcgcacgtcgagttcgagacaatattcaaaacgaatccaag
gcaatagggggaatgacgatgaccaaggcactgattgtggtggatgtgcagccgacgttc
tgtgaaggcggcgaactgggagtcgaaggcggcaacgcggtcgccgagcggatcgccgat
tatgtgaacgcgcatcgcagcgagtacgcgtatatcgcaaccacgcaggactggcatatc
gagccgggcgcgcactggtcggcggaaccggatttcgtggacacgtggccgaagcatggt
gcggccggcacgccgaacgccgaattgcatacggcgatcaaggcgctgaatatccagcat
catttcaagaagggccagtattcggcggcatattccggttttgagggcatcgaggacaat
accgaccgtatccagacccgcgaggaggtcacggccgagcaatccgccggcaagacgctg
gccaatgcgctgaaggccgccggcgtgagtcgcgtggatgtggtgggcatcgccgaatcg
cattgcgtcaaggacaccgcgctcgatgccgggaagcttggtttcgaggtcaccgtgttc
gagggcctgaccgtaccggtcagcgaggagctcggtgtcgctgcccgcaaacagatgacg
gcggccagcatcacattggccgagtcccgctga

DBGET integrated database retrieval system