KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1790Help
Entry
BLIJ_1790         CDS       T02092                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLIJ_1790
   01230 Biosynthesis of amino acids
    BLIJ_1790
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLIJ_1790
  Energy metabolism
   00680 Methane metabolism
    BLIJ_1790
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLIJ_1790
Enzymes [BR:blon01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLIJ_1790
Exosome [BR:blon04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLIJ_1790
  Exosomal proteins of melanoma cells
   BLIJ_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1896777..1897475
Genome map
AA seq 232 aa AA seqDB search
MTNHVRSIFLIRHGRTSYNAAHKLQGQVDIPLDAVGEWQVKQTATALKSLYVDRRPEIDN
RFIVCSDLKRAHATAQAFADVLGGIEPVDDPRIRERSFGDWDGLAVAELAERYPEDFRSW
MESRGGELKYGAEPKEAVGKRGMEALEDWSTRAGDDTDLFVFSHGAWIAQTLQTLLGISA
IDPTFSTVVSLRNAHWVCLVPMDNPDGTVRWRLLDYNHGPAIADTDEWERER
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatcatgttcgttccatttttcttattcgtcatggacgcacttcctataacgcc
gcccacaagctccaaggccaggtcgatattccgctggacgccgtgggtgaatggcaggtc
aagcagaccgccacggccttgaaaagcctgtacgtcgatcgtcggccggaaatcgacaat
cgattcattgtctgctccgatttgaagcgtgcgcacgccaccgcgcaggctttcgccgac
gtattgggtggaatcgagcccgtcgatgatcctcgcattcgtgaacgcagcttcggggat
tgggatggccttgccgtggctgaactggccgaacgctaccctgaggacttccgttcctgg
atggagtctcggggcggtgaactgaagtatggtgccgaacccaaggaagccgtaggcaaa
cgcggtatggaggctcttgaggactggtccacgcgtgccggagacgacacggacctgttc
gtgttctcgcacggcgcatggatcgcgcagacattgcagaccctgttgggcatttccgcg
atcgatccgaccttctccacggtggtctcattgcgcaatgcgcactgggtgtgcttggtg
ccgatggacaatcctgatggcactgtgcgctggcgtctgctggactacaatcacggtccg
gccatcgccgacaccgacgagtgggagcgcgaacgctga

DBGET integrated database retrieval system