KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1790Help
Entry
BLIJ_1790         CDS       T02092                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K22306  
glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Brite
Enzymes [BR:blon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     BLIJ_1790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1896777..1897475
Genome map
AA seq 232 aa AA seqDB search
MTNHVRSIFLIRHGRTSYNAAHKLQGQVDIPLDAVGEWQVKQTATALKSLYVDRRPEIDN
RFIVCSDLKRAHATAQAFADVLGGIEPVDDPRIRERSFGDWDGLAVAELAERYPEDFRSW
MESRGGELKYGAEPKEAVGKRGMEALEDWSTRAGDDTDLFVFSHGAWIAQTLQTLLGISA
IDPTFSTVVSLRNAHWVCLVPMDNPDGTVRWRLLDYNHGPAIADTDEWERER
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatcatgttcgttccatttttcttattcgtcatggacgcacttcctataacgcc
gcccacaagctccaaggccaggtcgatattccgctggacgccgtgggtgaatggcaggtc
aagcagaccgccacggccttgaaaagcctgtacgtcgatcgtcggccggaaatcgacaat
cgattcattgtctgctccgatttgaagcgtgcgcacgccaccgcgcaggctttcgccgac
gtattgggtggaatcgagcccgtcgatgatcctcgcattcgtgaacgcagcttcggggat
tgggatggccttgccgtggctgaactggccgaacgctaccctgaggacttccgttcctgg
atggagtctcggggcggtgaactgaagtatggtgccgaacccaaggaagccgtaggcaaa
cgcggtatggaggctcttgaggactggtccacgcgtgccggagacgacacggacctgttc
gtgttctcgcacggcgcatggatcgcgcagacattgcagaccctgttgggcatttccgcg
atcgatccgaccttctccacggtggtctcattgcgcaatgcgcactgggtgtgcttggtg
ccgatggacaatcctgatggcactgtgcgctggcgtctgctggactacaatcacggtccg
gccatcgccgacaccgacgagtgggagcgcgaacgctga

DBGET integrated database retrieval system