KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_1908Help
Entry
BLIJ_1908         CDS       T02092                                 

Definition
putative beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blon00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BLIJ_1908
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BLIJ_1908
Enzymes [BR:blon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BLIJ_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2010457..2011662
Genome map
AA seq 401 aa AA seqDB search
MATICALAVVLAGVAAYEWHVGWFAKSTSDGNTAAPQTSRTSVLPRTDAPSPKKNDAPAA
QAQRAVSAMTLEERVGQLVMVPLFAGSDPSSLASTIADEHIGSAILIGNWNTGVDTVKTA
TAQLQGYAPAGNRLIIATDQEGGQVQHLTGTGFDTMPSAVEQGTMSADALRQSAGTWGSQ
LAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRGAQVGAA
VKHYPGLGAVSGNTDFTTEGILDTTTTLDGAEAGAFDQAITKADPAMVMMSLATYQSIDP
NNPAVFSSTIIDGHIRNALKYTGVVISDSISAEALSSYDVSQLGVKLVEAGGDMSCIGQT
DYVKPVVDGLNERAKSDPAFASKVTAAATRVMTLKIKMGLA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacaatatgtgctttggcagtggtgttggccggcgtggcagcctacgaatggcat
gtcggatggttcgccaaatccacatcagacggcaacaccgccgctccccagacctcccgg
acaagtgtgttaccacgcaccgacgctccttccccgaagaagaacgacgccccggccgca
caagcccaacgtgcggtatccgccatgacacttgaggaacgtgtgggacagttagtgatg
gtgccgttgttcgccggttccgatccctcctcgttggcttcaacaatcgccgacgagcac
attggctcggccattctcattggcaattggaataccggcgtcgatacggtcaagaccgcg
accgcgcaactccaaggatatgcgccggccggcaatcgtctcatcatcgccaccgatcag
gagggtggtcaggtacagcatctgactggtaccggtttcgacacaatgcccagtgccgtt
gagcagggcacaatgtccgctgacgcattgcgtcaatcggcaggcacgtggggttcgcaa
ttagctgctgctggcataaatgtcgatttggcaccggtgctcggcacggtggtgggcgat
cgtgcctcgaatgctccgattggcgcgctggatcgtgatttcggattggatgcggccggt
aacgccgagcatggcatcgccgttattgagggtttgcgaggcgctcaggtcggtgcggcg
gtcaaacattatcctgggttgggcgcggtaagcggcaataccgacttcaccaccgaaggc
attctggatacgaccaccacgttggacggggccgaggcaggtgcctttgaccaggcgatc
accaaggccgatcctgcaatggtgatgatgtcgttggccacgtatcaatccatcgatccg
aataatccggcggtgttttcttctacgattatcgacggccatattcgcaacgccctgaaa
tatacgggcgtggtgatttcggattcgatatctgccgaagcgttaagcagctacgatgta
agccaattgggagtaaagctcgtcgaggcgggcggcgacatgtcctgcatcggtcagacg
gattacgtaaagccagttgtggacggcctcaacgaacgggcgaagtccgatccggctttc
gcttcgaaagtgacggcggcggcgactcgcgtaatgacattgaaaatcaagatgggactg
gcctga

DBGET integrated database retrieval system