KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo): BLIJ_2218Help
Entry
BLIJ_2218         CDS       T02092                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
blon  Bifidobacterium longum subsp. infantis ATCC 15697 (Tokyo)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:blon00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:blon00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2366874..2367536)
Genome map
AA seq 220 aa AA seqDB search
MEHDSSRSGYHEPEPGSAGLSATEEDWGDDYPKTFSVNLIWAEARDKEGRAGAIGLNGGM
PWHCAEDMKHFKELTVSHPVIMGRKTWESLGVKYRPLPNRDNIVVSHDPMYRAPGATVVT
SLDDALDMARQEAIPDDGLDRSEIWIIGGAQLFAEALPFADKAYVTDLAATVDADSYAPD
MASLVEAGMWREAEVGEWHTPAKEESGIDSYRFRILAKTK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggagcatgacagtagccgtagcggctatcacgaacccgagcccggatctgccgggctg
tctgccactgaagaagactggggtgacgattatcccaagaccttctcggtgaatcttatc
tgggccgaagcccgcgacaaggaaggtcgcgccggtgccatcggcctcaatggcggcatg
ccttggcactgtgccgaggatatgaagcatttcaaggagctgaccgtctcccatccggtg
attatgggtcgtaagacttgggaatcgctgggggtcaagtaccggccgctgcccaaccgc
gacaacatcgtcgtttcccacgatccgatgtaccgtgcgccgggggccactgtggtcacc
agtcttgacgacgcgctcgatatggcccgtcaggaggcgattccggacgacggtctggac
cgttcggagatttggatcatcggcggtgcccagctgttcgccgaggctttgccgttcgcg
gacaaagcctatgtgactgatctggccgccaccgtggatgccgacagctacgcgcccgat
atggcgtcgctggtcgaggccgggatgtggcgggaagccgaagtgggcgagtggcatacg
cccgccaaggaggagtccggcatcgattcctatcgtttccgtatcttggctaaaaccaag
tga

DBGET integrated database retrieval system